Target Information

Target General Infomation
Target ID
T22839
Former ID
TTDR00230
Target Name
Elastase 1
Gene Name
CELA1
Synonyms
Elastase; CELA1
Target Type
Successful
Disease Alpha-1 antitrypsin deficiency [ICD9: 273.4; ICD10: E88.0]
Bronchitis [ICD10: J20-J21, J42]
Cystic fibrosis [ICD9: 277; ICD10: E84]
Chronic obstructive pulmonary disease [ICD9: 490-492, 494-496; ICD10: J40-J44, J47]
Emphysema [ICD9: 492; ICD10: J43]
Inflammatory disease [ICD9: 140-229, 147, 173, 573.3, 710-719; ICD10: C11, C44, K75.9, M00-M25]
Function
Acts upon elastin.
BioChemical Class
Peptidase
Target Validation
T22839
UniProt ID
Q9UNI1
EC Number
EC 3.4.21.36
Sequence
MLVLYGHSTQDLPETNARVVGGTEAGRNSWPSQISLQYRSGGSRYHTCGGTLIRQNWVMT
AAHCVDYQKTFRVVAGDHNLSQNDGTEQYVSVQKIVVHPYWNSDNVAAGYDIALLRLAQS
VTLNSYVQLGVLPQEGAILANNSPCYITGWGKTKTNGQLAQTLQQAYLPSVDYAICSSSS
YWGSTVKNTMVCAGGDGVRSGCQGDSGGPLHCLVNGKYSVHGVTSFVSSRGCNVSRKPTV
FTQVSAYISWINNVIASN
Drugs and Mode of Action
Drug(s) Alpha 1-PI Drug Info Approved Alpha-1 antitrypsin deficiency [545546], [551871]
Erdosteine Drug Info Approved Bronchitis [551871]
Sivelestat Drug Info Phase 4 Discovery agent [521724], [541582]
Mdl 101,146 Drug Info Terminated Inflammatory disease [546375]
PBI-1101 Drug Info Terminated Inflammatory disease [547638]
SSR-69071 Drug Info Terminated Chronic obstructive pulmonary disease [547262]
SYN-1134 Drug Info Terminated Cystic fibrosis [547708]
WIN-63759 Drug Info Terminated Emphysema [546320]
Inhibitor (2-BROMOETHYL)(2-'FORMYL-4'-AMINOPHENYL) ACETATE Drug Info [551374]
(Tert-Butyloxycarbonyl)-Alanyl-Alanyl-Amine Drug Info [551393]
Acetate Ion Drug Info [551393]
Acetyl-Ala-Ala-Pro-Ala-trifluromethane Drug Info [532036]
Acetyl-Pro-Ala-Pro-Ala-trifluoro methane Drug Info [532036]
Alpha 1-PI Drug Info [535306]
Dimethylformamide Drug Info [551397]
GRASSYSTATIN A Drug Info [530345]
Mdl 101,146 Drug Info [551393]
MOLASSAMIDE Drug Info [530586]
Para-Isopropylaniline Drug Info [551393]
PBI-1101 Drug Info [550871]
Sivelestat Drug Info [537405]
SSR-69071 Drug Info [531528]
SYN-1134 Drug Info [550874]
Modulator Erdosteine Drug Info [551871]
WIN-63759 Drug Info [550030]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
References
Ref 521724ClinicalTrials.gov (NCT00219375) Study of Sivelestat Sodium Hydrate in Acute Lung Injury (ALI) Associated With Systemic Inflammatory Response Syndrome (SIRS) in Japan. U.S. National Institutes of Health.
Ref 541582(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6441).
Ref 545546Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003666)
Ref 546320Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007449)
Ref 546375Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007771)
Ref 547262Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800014569)
Ref 547638Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018032)
Ref 547708Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018646)
Ref 551871Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
Ref 530345J Med Chem. 2009 Sep 24;52(18):5732-47.Grassystatins A-C from marine cyanobacteria, potent cathepsin E inhibitors that reduce antigen presentation.
Ref 530586J Nat Prod. 2010 Mar 26;73(3):459-62.Molassamide, a depsipeptide serine protease inhibitor from the marine cyanobacterium Dichothrix utahensis.
Ref 531528Pivotal role for alpha1-antichymotrypsin in skin repair. J Biol Chem. 2011 Aug 19;286(33):28889-901.
Ref 532036J Med Chem. 1990 Jan;33(1):394-407.Synthesis of peptidyl fluoromethyl ketones and peptidyl alpha-keto esters as inhibitors of porcine pancreatic elastase, human neutrophil elastase, and rat and humanneutrophil cathepsin G.
Ref 535306Elastase inhibitors. J Soc Biol. 2001;195(2):143-50.
Ref 537405Sivelestat (selective neutrophil elastase inhibitor) improves the mortality rate of sepsis associated with both ARDS and DIC patients. Shock. 2009 May 18.
Ref 550030Biological activity of WIN 63759, an orally bioavailable inhibitor of human neutrophil elastase. Drug Development Research Volume 34, Issue 3, pages 306-316, March 1995.
Ref 550871CN patent application no. 1813706, Use of elastic protease inhibitor for preparing medicine for protecting cerebral hemorrhage.
Ref 550874EP patent application no. 1292314, Method for treating respiratory disorders associated with pulmonary elastic fiber injury comprising the use of glycosaminoglycans.
Ref 551374The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
Ref 551393How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
Ref 551397Liver disease associated with occupational exposure to the solvent dimethylformamide. Ann Intern Med. 1988 May;108(5):680-6.
Ref 551871Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.