Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T17852
|
||||
Former ID |
TTDI02148
|
||||
Target Name |
Phosphodiesterase (PDE) 9
|
||||
Gene Name |
PDE9A
|
||||
Synonyms |
High affinity cGMPspecific 3',5'cyclic phosphodiesterase 9A; PDE9A
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Alzheimer disease [ICD9: 331; ICD10: G30] | ||||
Cognitive disorders [ICD9: 290-294, 294.0, 780.09, 780.9, 780.93; ICD10: F01-F07, F04, F05, R41.3] | |||||
Genitourinary disease [ICD10: N00-N99] | |||||
Psychiatric disorder [ICD9: 290-319; ICD10: F01-F99] | |||||
Function |
Hydrolyzes the second messengercGMP, which is a key regulator of many important physiological processes. {ECO:0000269|PubMed:18757755}.
|
||||
BioChemical Class |
Phosphoric diester hydrolases
|
||||
UniProt ID | |||||
EC Number |
EC 3.1.4.35
|
||||
Sequence |
MGSGSSSYRPKAIYLDIDGRIQKVIFSKYCNSSDIMDLFCIATGLPRNTTISLLTTDDAM
VSIDPTMPANSERTPYKVRPVAIKQLSAGVEDKRTTSRGQSAERPLRDRRVVGLEQPRRE GAFESGQVEPRPREPQGCYQEGQRIPPEREELIQSVLAQVAEQFSRAFKINELKAEVANH LAVLEKRVELEGLKVVEIEKCKSDIKKMREELAARSSRTNCPCKYSFLDNHKKLTPRRDV PTYPKYLLSPETIEALRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPVTLRRWLF CVHDNYRNNPFHNFRHCFCVAQMMYSMVWLCSLQEKFSQTDILILMTAAICHDLDHPGYN NTYQINARTELAVRYNDISPLENHHCAVAFQILAEPECNIFSNIPPDGFKQIRQGMITLI LATDMARHAEIMDSFKEKMENFDYSNEEHMTLLKMILIKCCDISNEVRPMEVAEPWVDCL LEEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPMVEEIML QPLWESRDRYEELKRIDDAMKELQKKTDSLTSGATEKSRERSRDVKNSEGDCA |
||||
Drugs and Mode of Action | |||||
Drug(s) | ASP-4901 | Drug Info | Phase 2 | Genitourinary disease | [1] |
BI-409306 | Drug Info | Phase 2 | Psychiatric disorder | [2] | |
PF-4447943 | Drug Info | Phase 2 | Alzheimer disease | [3] | |
Inhibitor | ASP-4901 | Drug Info | [4] | ||
BI-409306 | Drug Info | [5] | |||
PF-04447943 | Drug Info | [6] | |||
PF-4181366 | Drug Info | [6] | |||
PF-4447943 | Drug Info | [7] | |||
SCH51866 | Drug Info | [8] | |||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Purine metabolism | ||||
Pathway Interaction Database | Regulation of Androgen receptor activity | ||||
Reactome | cGMP effects | ||||
References | |||||
REF 1 | ClinicalTrials.gov (NCT02038868) A Study to Evaluate the Efficacy and Safety of ASP4901 in Patients With Benign Prostate Hyperplasia. U.S. National Institutes of Health. | ||||
REF 2 | ClinicalTrials.gov (NCT02240693) Alzheimer Disease Proof of Concept Study With BI 409306 Versus Placebo. U.S. National Institutes of Health. | ||||
REF 3 | ClinicalTrials.gov (NCT00930059) A Study Of PF-04447943 Compared To Placebo In Subjects With Mild To Moderate Alzheimer's Disease. U.S. National Institutes of Health. | ||||
REF 4 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800033070) | ||||
REF 5 | Clinical pipeline report, company report or official report of Boehringer Ingelheim pipeline. | ||||
REF 6 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1309). | ||||
REF 7 | A multicenter, double-blind, placebo-controlled trial of the PDE9A inhibitor, PF-04447943, in Alzheimer's disease. Curr Alzheimer Res. 2014;11(5):413-21. | ||||
REF 8 | Isolation and characterization of PDE9A, a novel human cGMP-specific phosphodiesterase. J Biol Chem. 1998 Jun 19;273(25):15559-64. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.