Target Information

Target General Infomation
Target ID
T23347
Former ID
TTDC00234
Target Name
Interleukin-1 receptor, type II
Gene Name
IL1R2
Synonyms
Antigen CDw121b; IL-1R-2; IL-1R-beta; Interleukin 1 receptor type II; IL1R2
Target Type
Clinical Trial
Disease Arthritis [ICD9: 710-719; ICD10: M00-M25]
Immune disorder [ICD10: D80-D89]
Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06]
Function
Non-signaling receptor for IL1A, IL1B and IL1RN. Reduces IL1B activities. Serves as a decoy receptor by competetive binding to IL1B and preventing its binding to IL1R1. Also modulates cellular response through non-signaling association with IL1RAP after binding to IL1B. IL1R2 (membrane and secreted forms) preferentially binds IL1B and poorly IL1A and IL1RN. The secreted IL1R2 recruits secreted IL1RAP with high affinity; this complexformation may be the dominant mechanism for neutralization of IL1B by secreted/soluble receptors.
BioChemical Class
Interleukin receptor family
Target Validation
T23347
UniProt ID
P27930
Sequence
MLRLYVLVMGVSAFTLQPAAHTGAARSCRFRGRHYKREFRLEGEPVALRCPQVPYWLWAS
VSPRINLTWHKNDSARTVPGEEETRMWAQDGALWLLPALQEDSGTYVCTTRNASYCDKMS
IELRVFENTDAFLPFISYPQILTLSTSGVLVCPDLSEFTRDKTDVKIQWYKDSLLLDKDN
EKFLSVRGTTHLLVHDVALEDAGYYRCVLTFAHEGQQYNITRSIELRIKKKKEETIPVII
SPLKTISASLGSRLTIPCKVFLGTGTPLTTMLWWTANDTHIESAYPGGRVTEGPRQEYSE
NNENYIEVPLIFDPVTREDLHMDFKCVVHNTLSFQTLRTTVKEASSTFSWGIVLAPLSLA
FLVLGGIWMHRRCKHRTGKADGLTVLWPHHQDFQSYPK
Drugs and Mode of Action
Drug(s) GSK-1827771 Drug Info Phase 1 Rheumatoid arthritis [522135]
AMG 108 Drug Info Discontinued in Phase 2 Rheumatoid arthritis [547930]
FR-133605 Drug Info Terminated Arthritis [534263]
MRL-953 Drug Info Terminated Immune disorder [545071]
Antagonist AMG 108 Drug Info [536524], [550250]
Modulator FR-133605 Drug Info [534263]
Agonist MRL-953 Drug Info [534068]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway MAPK signaling pathway
Cytokine-cytokine receptor interaction
Hematopoietic cell lineage
Amoebiasis
HTLV-I infection
Transcriptional misregulation in cancer
NetPath Pathway IL1 Signaling Pathway
TNFalpha Signaling Pathway
Pathway Interaction Database IL1-mediated signaling events
Reactome Interleukin-1 signaling
WikiPathways MAPK Signaling Pathway
Interleukin-1 signaling
Apoptosis Modulation and Signaling
References
Ref 522135ClinicalTrials.gov (NCT00539760) A Phase I Rheumatoid Arthritis Study in Healthy Volunteers. U.S. National Institutes of Health.
Ref 534263Effect of FR133605, a novel cytokine suppressive agent, on bone and cartilage destruction in adjuvant arthritic rats. J Rheumatol. 1996 Oct;23(10):1778-83.
Ref 545071Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002036)
Ref 547930Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800020487)
Ref 534068SDZ MRL 953, a lipid A analog as selective cytokine inducer. Prog Clin Biol Res. 1995;392:549-65.
Ref 534263Effect of FR133605, a novel cytokine suppressive agent, on bone and cartilage destruction in adjuvant arthritic rats. J Rheumatol. 1996 Oct;23(10):1778-83.
Ref 536524Inflammatory molecules: a target for treatment of systemic autoimmune diseases. Autoimmun Rev. 2007 Nov;7(1):1-7. Epub 2007 Mar 26.
Ref 550163WO patent application no. 2013,0077,63, Modulators of the nlrp3 inflammasome il-1ss pathway for the prevention and treatment of acne.
Ref 550250Clinical pipeline report, company report or official report of Amgen (2009).

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.