Target General Infomation
Target ID
T97257
Former ID
TTDR00511
Target Name
Transforming growth factor beta 1
Gene Name
TGFB1
Synonyms
TGF-beta 1; TGF-beta1; TGFB1
Target Type
Successful
Disease Arthritis [ICD9: 710-719; ICD10: M00-M25]
Idiopathic pulmonary fibrosis [ICD9: 516.3; ICD10: J84.1]
Lesion [ICD10: S00-T98]
Macular degeneration [ICD9: 362.5; ICD10: H35.3]
Osteoarthritis [ICD9: 715; ICD10: M15-M19, M47]
Function
Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negatively regulates many other growth factors. It plays an important role in bone remodeling as it is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts.
BioChemical Class
Growth factor
UniProt ID
Sequence
MPPSGLRLLLLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
SPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEI
YDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWR
YLSNRLLAPSDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFT
TGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYI
DFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQA
LEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Drugs and Mode of Action
Drug(s) Pirfenidone Drug Info Approved Idiopathic pulmonary fibrosis [533123], [542537], [551871]
TG-C Drug Info Phase 3 Arthritis [524657]
Disitertide Drug Info Phase 2 Macular degeneration [544387]
Mannose phosphate Drug Info Discontinued in Phase 2 Lesion [532992]
Modulator ART-144 Drug Info [550306]
Mannose phosphate Drug Info [533229]
Pirfenidone Drug Info [556264]
TG-C Drug Info [524657], [551735]
Inhibitor Disitertide Drug Info [544387]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway MAPK signaling pathway
Cytokine-cytokine receptor interaction
FoxO signaling pathway
Cell cycle
Endocytosis
TGF-beta signaling pathway
Osteoclast differentiation
Hippo signaling pathway
Intestinal immune network for IgA production
Non-alcoholic fatty liver disease (NAFLD)
Leishmaniasis
Chagas disease (American trypanosomiasis)
Malaria
Toxoplasmosis
Amoebiasis
Tuberculosis
Hepatitis B
HTLV-I infection
Pathways in cancer
Proteoglycans in cancer
Colorectal cancer
Renal cell carcinoma
Pancreatic cancer
Chronic myeloid leukemia
Inflammatory bowel disease (IBD)
Rheumatoid arthritis
Hypertrophic cardiomyopathy (HCM)
Dilated cardiomyopathy
NetPath Pathway TCR Signaling Pathway
IL3 Signaling Pathway
TGF_beta_Receptor Signaling Pathway
Pathway Interaction Database Glypican 1 network
IL27-mediated signaling events
Regulation of Telomerase
RXR and RAR heterodimerization with other nuclear receptor
AP-1 transcription factor network
Urokinase-type plasminogen activator (uPA) and uPAR-mediated signaling
ALK1 signaling events
Syndecan-1-mediated signaling events
Syndecan-2-mediated signaling events
TGF-beta receptor signaling
IL12 signaling mediated by STAT4
Reactome Platelet degranulation
Molecules associated with elastic fibres
TGF-beta receptor signaling activates SMADs
TGF-beta receptor signaling in EMT (epithelial to mesenchymal transition)
Syndecan interactions
ECM proteoglycans
SMAD2/3 Phosphorylation Motif Mutants in Cancer
SMAD2/3 MH2 Domain Mutants in Cancer
TGFBR2 Kinase Domain Mutants in Cancer
TGFBR1 KD Mutants in Cancer
TGFBR1 LBD Mutants in Cancer
Transcriptional regulation of white adipocyte differentiation
WikiPathways DNA Damage Response (only ATM dependent)
TCR Signaling Pathway
Senescence and Autophagy in Cancer
TGF Beta Signaling Pathway
ACE Inhibitor Pathway
Cytokines and Inflammatory Response
Endochondral Ossification
MAPK Signaling Pathway
TGF beta Signaling Pathway
NRF2 pathway
Nuclear Receptors Meta-Pathway
Vitamin D Receptor Pathway
Aryl Hydrocarbon Receptor Pathway
Extracellular vesicle-mediated signaling in recipient cells
IL-3 Signaling Pathway
Dopaminergic Neurogenesis
Endoderm Differentiation
Hematopoietic Stem Cell Differentiation
Differentiation Pathway
Cytodifferentiation (Part 3 of 3)
Cardiac Hypertrophic Response
Syndecan interactions
Host Interactions with Influenza Factors
Transcriptional Regulation of White Adipocyte Differentiation
Signaling by TGF-beta Receptor Complex
Extracellular matrix organization
Elastic fibre formation
Primary Focal Segmental Glomerulosclerosis FSGS
Spinal Cord Injury
Cardiac Progenitor Differentiation
Integrated Pancreatic Cancer Pathway
Adipogenesis
Corticotropin-releasing hormone
Interleukin-11 Signaling Pathway
Allograft Rejection
Cell Cycle
TFs Regulate miRNAs related to cardiac hypertrophy
MicroRNAs in cardiomyocyte hypertrophy
References
Ref 524657ClinicalTrials.gov (NCT02072070) Efficacy and Safety Study of TissueGene-C to Degenerative Arthritis. U.S. National Institutes of Health.
Ref 532992Mannose phosphate isomerase regulates fibroblast growth factor receptor family signaling and glioma radiosensitivity. PLoS One. 2014 Oct 14;9(10):e110345.
Ref 5331232014 FDA drug approvals. Nat Rev Drug Discov. 2015 Feb;14(2):77-81.
Ref 542537(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7532).
Ref 544387Perspectives of TGF-beta inhibition in pancreatic and hepatocellular carcinomas. Oncotarget. 2014 January; 5(1): 78-94.
Ref 551871Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
Ref 524657ClinicalTrials.gov (NCT02072070) Efficacy and Safety Study of TissueGene-C to Degenerative Arthritis. U.S. National Institutes of Health.
Ref 533229The mannose-6-phosphate analogue, PXS64, inhibits fibrosis via TGF-beta1 pathway in human lung fibroblasts. Immunol Lett. 2015 Jun;165(2):90-101.
Ref 544387Perspectives of TGF-beta inhibition in pancreatic and hepatocellular carcinomas. Oncotarget. 2014 January; 5(1): 78-94.
Ref 550306Pharmaceutical products of TORREYA partners. December 2011.
Ref 551735Clinical pipeline report, company report or official report of Tissue Gene, Inc.
Ref 556264Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.