Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T95400
|
||||
| Former ID |
TTDS00484
|
||||
| Target Name |
High affinity immunoglobulin epsilon receptor
|
||||
| Gene Name |
FCER1G
|
||||
| Synonyms |
Fc-epsilon RI-gamma; FceRI gamma; IgE Fc receptor subunit gamma; FCER1G
|
||||
| Target Type |
Successful
|
||||
| Disease | Asthma; Chronic idiopathic urticaria [ICD10: J45, L50] | ||||
| Bacterial infections [ICD9: 001-009, 010-018, 020-027, 030-041, 080-088, 090-099, 100-104; ICD10: A00-B99] | |||||
| Chronic idiopathic urticaria [ICD9: 708; ICD10: L50] | |||||
| Function |
Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.
|
||||
| UniProt ID | |||||
| Sequence |
MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEK
SDGVYTGLSTRNQETYETLKHEKPPQ |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Benzylpenicilloyl Polylysine | Drug Info | Approved | Bacterial infections | [1], [2] |
| Omalizumab | Drug Info | Approved | Asthma; Chronic idiopathic urticaria | [3], [4], [5], [6] | |
| Omalizumab | Drug Info | Phase 2 | Chronic idiopathic urticaria | [3], [4] | |
| Inhibitor | Alpha-D-Mannose | Drug Info | [7] | ||
| Fucose | Drug Info | [7] | |||
| Binder | Benzylpenicilloyl Polylysine | Drug Info | [8] | ||
| Modulator | Omalizumab | Drug Info | [9] | ||
| Pathways | |||||
| KEGG Pathway | Sphingolipid signaling pathway | ||||
| Fc epsilon RI signaling pathway | |||||
| Asthma | |||||
| PathWhiz Pathway | Fc Epsilon Receptor I Signaling in Mast Cells | ||||
| Reactome | Fc epsilon receptor (FCERI) signaling | ||||
| Role of LAT2/NTAL/LAB on calcium mobilization | |||||
| FCERI mediated MAPK activation | |||||
| FCERI mediated Ca+2 mobilization | |||||
| FCERI mediated NF-kB activation | |||||
| WikiPathways | IL1 and megakaryotyces in obesity | ||||
| Fc epsilon receptor (FCERI) signaling | |||||
| References | |||||
| REF 1 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | ||||
| REF 2 | Drug information of Benzylpenicilloyl Polylysine, 2008. eduDrugs. | ||||
| REF 3 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20. | ||||
| REF 4 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6890). | ||||
| REF 5 | ClinicalTrials.gov (NCT00546143) Safety and Tolerability of Omalizumab in Patients With Mild to Moderate Asthma | ||||
| REF 6 | ClinicalTrials.gov (NCT01701583) Effect of Omalizumab (Xolair) on Basophils in Patients With Chronic Idiopathic Urticaria | ||||
| REF 7 | How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | ||||
| REF 8 | Penicillin allergy: anti-penicillin IgE antibodies and immediate hypersensitivity skin reactions employing major and minor determinants of penicillin. Arch Dis Child. 1980 Nov;55(11):857-60. | ||||
| REF 9 | The potential of biologics for the treatment of asthma. Nat Rev Drug Discov. 2012 Dec;11(12):958-72. doi: 10.1038/nrd3792. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.