Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T94309
|
||||
| Former ID |
TTDC00295
|
||||
| Target Name |
Triacylglycerol lipase, pancreatic
|
||||
| Gene Name |
PNLIP
|
||||
| Synonyms |
PL; Pancreatic lipase; PNLIP
|
||||
| Target Type |
Successful
|
||||
| Disease | Bacterial infections [ICD9: 001-009, 010-018, 020-027, 030-041, 080-088, 090-099, 100-104; ICD10: A00-B99] | ||||
| Cystic fibrosis [ICD9: 277; ICD10: E84] | |||||
| Exocrine pancreatic insufficiency [ICD10: K86.8] | |||||
| Obesity [ICD9: 278; ICD10: E66] | |||||
| Pancreatic disease [ICD10: K85-K86] | |||||
| BioChemical Class |
Carboxylic ester hydrolase
|
||||
| Target Validation |
T94309
|
||||
| UniProt ID | |||||
| EC Number |
EC 3.1.1.3
|
||||
| Sequence |
MLPLWTLSLLLGAVAGKEVCYERLGCFSDDSPWSGITERPLHILPWSPKDVNTRFLLYTN
ENPNNFQEVAADSSSISGSNFKTNRKTRFIIHGFIDKGEENWLANVCKNLFKVESVNCIC VDWKGGSRTGYTQASQNIRIVGAEVAYFVEFLQSAFGYSPSNVHVIGHSLGAHAAGEAGR RTNGTIGRITGLDPAEPCFQGTPELVRLDPSDAKFVDVIHTDGAPIVPNLGFGMSQVVGH LDFFPNGGVEMPGCKKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPDGFAGF PCASYNVFTANKCFPCPSGGCPQMGHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVS VTLSGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQMVKFIWY NNVINPTLPRVGASKIIVETNVGKQFNFCSPETVREEVLLTLTPC |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Dalbavancin | Drug Info | Approved | Bacterial infections | [1], [2] |
| Orlistat | Drug Info | Approved | Obesity | [3], [4] | |
| Pancrecarb | Drug Info | NDA filed | Pancreatic disease | [5] | |
| Liprotamase | Drug Info | Phase 3 | Cystic fibrosis | [6] | |
| MS-1819 | Drug Info | Phase 1/2 | Exocrine pancreatic insufficiency | [7] | |
| AZM-131 | Drug Info | Terminated | Obesity | [8] | |
| Inhibitor | (Hydroxyethyloxy)Tri(Ethyloxy)Octane | Drug Info | [9] | ||
| B-Nonylglucoside | Drug Info | [10] | |||
| B-Octylglucoside | Drug Info | [9] | |||
| Daio-Orengedokuto (DOT) | Drug Info | [11] | |||
| Dalbavancin | Drug Info | [12], [13] | |||
| METHOXYUNDECYLPHOSPHINIC ACID | Drug Info | [10] | |||
| Modulator | AZM-131 | Drug Info | [14] | ||
| Liprotamase | Drug Info | [15] | |||
| MS-1819 | Drug Info | [16] | |||
| Orlistat | Drug Info | [17] | |||
| Pancrecarb | Drug Info | [5] | |||
| Pathways | |||||
| BioCyc Pathway | Triacylglycerol degradation | ||||
| Retinol biosynthesis | |||||
| KEGG Pathway | Glycerolipid metabolism | ||||
| Metabolic pathways | |||||
| Pancreatic secretion | |||||
| Fat digestion and absorption | |||||
| Vitamin digestion and absorption | |||||
| Reactome | Retinoid metabolism and transport | ||||
| WikiPathways | Visual phototransduction | ||||
| Lipid digestion, mobilization, and transport | |||||
| References | |||||
| REF 1 | 2014 FDA drug approvals. Nat Rev Drug Discov. 2015 Feb;14(2):77-81. | ||||
| REF 2 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | ||||
| REF 3 | Obesity and pharmacologic therapy. Endocrinol Metab Clin North Am. 2003 Dec;32(4):1005-24. | ||||
| REF 4 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5277). | ||||
| REF 5 | Clinical pipeline report, company report or official report of Digestive Care. | ||||
| REF 6 | ClinicalTrials.gov (NCT00500084) Phase III ALTU-135 CP Safety Trial. U.S. National Institutes of Health. | ||||
| REF 7 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800030334) | ||||
| REF 8 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008694) | ||||
| REF 9 | How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | ||||
| REF 10 | The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. | ||||
| REF 11 | Daio-Orengedokuto inhibits HMG-CoA reductase and pancreatic lipase. Biol Pharm Bull. 2002 Nov;25(11):1442-5. | ||||
| REF 12 | Dalbavancin: a novel once-weekly lipoglycopeptide antibiotic. Clin Infect Dis. 2008 Feb 15;46(4):577-83. | ||||
| REF 13 | Pfizer. Product Development Pipeline. March 31 2009. | ||||
| REF 14 | US patent application no. 7217,697, Glucopyranosyloxypyrazole derivative medicinal composition containing the same medicinal use thereof and intermediate therefor. | ||||
| REF 15 | Clinical pipeline report, company report or official report of Anthera Pharmaceuticals. | ||||
| REF 16 | Clinical pipeline report, company report or official report of AzurRx. | ||||
| REF 17 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.