Target Information

Target General Infomation
Target ID
T87075
Former ID
TTDS00473
Target Name
T-cell surface glycoprotein CD3 epsilon chain
Gene Name
CD3E
Synonyms
CD3e; T-cell surface antigen T3/Leu-4 epsilon chain; T3E; CD3E
Target Type
Successful
Disease Advanced breast cancer [ICD9: 174, 175; ICD10: C50]
Breast cancer [ICD9: 174, 175; ICD10: C50]
Melanoma [ICD9: 172; ICD10: C43]
Organ rejection [ICD9: 279.5, 996; ICD10: D89.8, T86]
Prostate cancer [ICD9: 185; ICD10: C61]
Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48]
Function
The CD3 complex mediates signal transduction.
Target Validation
T87075
UniProt ID
P07766
Sequence
MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQ
HNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCE
NCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERP
PPVPNPDYEPIRKGQRDLYSGLNQRRI
Drugs and Mode of Action
Drug(s) Muromonab Drug Info Approved Organ rejection [536361]
Ertumaxomab Drug Info Phase 2 Breast cancer [529707], [531972]
Resimmune Drug Info Phase 1/2 Melanoma [549482]
Autologous T-cell therapy Drug Info Phase 1 Prostate cancer [525412]
Ertumaxomab Drug Info Phase 1 Advanced breast cancer [889343]
MT-110 Drug Info Phase 1 Solid tumours [531707]
Binder Muromonab Drug Info [535879]
Modulator Resimmune Drug Info
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway Hematopoietic cell lineage
T cell receptor signaling pathway
Chagas disease (American trypanosomiasis)
Measles
HTLV-I infection
Primary immunodeficiency
NetPath Pathway TCR Signaling Pathway
Leptin Signaling Pathway
PANTHER Pathway T cell activation
Pathway Interaction Database TCR signaling in na&amp
#xef
ve CD4+ T cells
IL12-mediated signaling events
TCR signaling in na&amp
ve CD8+ T cells
CXCR4-mediated signaling events
IL23-mediated signaling events
Downstream signaling in na&amp
IL12 signaling mediated by STAT4
Reactome Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Phosphorylation of CD3 and TCR zeta chains
Translocation of ZAP-70 to Immunological synapse
Generation of second messenger molecules
PD-1 signaling
WikiPathways TCR Signaling Pathway
TCR signaling
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Costimulation by the CD28 family
References
Ref 525412Clinical application of genetically modified T cells in cancer therapy. Clin Transl Immunology. 2014 May 16;3(5):e16. doi: 10.1038/cti.2014.7. eCollection 2014.
Ref 529707Ertumaxomab: a trifunctional antibody for breast cancer treatment. Expert Opin Investig Drugs. 2008 Oct;17(10):1553-8.
Ref 531707EpCAM/CD3-Bispecific T-cell engaging antibody MT110 eliminates primary human pancreatic cancer stem cells. Clin Cancer Res. 2012 Jan 15;18(2):465-74.
Ref 531972Trifunctional antibody ertumaxomab: Non-immunological effects on Her2 receptor activity and downstream signaling. MAbs. 2012 Sep-Oct;4(5):614-22.
Ref 536361Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20.
Ref 549482Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800038158)
Ref 889343ClinicalTrials.gov (NCT00452140) Phase II Study With the Trifunctional Antibody Ertumaxomab to Treat Metastatic Breast Cancer Progressing After Endocrine Treatment
Ref 529707Ertumaxomab: a trifunctional antibody for breast cancer treatment. Expert Opin Investig Drugs. 2008 Oct;17(10):1553-8.
Ref 531707EpCAM/CD3-Bispecific T-cell engaging antibody MT110 eliminates primary human pancreatic cancer stem cells. Clin Cancer Res. 2012 Jan 15;18(2):465-74.
Ref 531972Trifunctional antibody ertumaxomab: Non-immunological effects on Her2 receptor activity and downstream signaling. MAbs. 2012 Sep-Oct;4(5):614-22.
Ref 532162Antitumor activities of PSMA?CD3 diabodies by redirected T-cell lysis of prostate cancer cells. Immunotherapy. 2013 Jan;5(1):27-38.
Ref 535879Basiliximab: a review of its use as induction therapy in renal transplantation. Drugs. 2003;63(24):2803-35.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.