Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T73712
|
||||
| Former ID |
TTDR00634
|
||||
| Target Name |
Fatty acid-binding protein, liver
|
||||
| Gene Name |
FABP1
|
||||
| Synonyms |
14 kDa selenium-binding protein; 14-kDa fatty-acid binding protein; L-FABP; FABP1
|
||||
| Target Type |
Discontinued
|
||||
| Disease | Gout [ICD9: 274.00274.1274.8274.9; ICD10: M10] | ||||
| Function |
Binds free fatty acids andtheir coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. May be involved in intracellular lipid transport.
|
||||
| BioChemical Class |
Calycin family
|
||||
| Target Validation |
T73712
|
||||
| UniProt ID | |||||
| Sequence |
MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQ
NEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVF KRISKRI |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | FENOFIBRIC ACID | Drug Info | Approved | Cardiovascular disease | [1] |
| INDOPROFEN | Drug Info | Withdrawn from market | Gout | [2] | |
| Inhibitor | 1-anilinonaphthalene-8-sulfonic acid | Drug Info | [3] | ||
| FENOFIBRIC ACID | Drug Info | [3] | |||
| INDOPROFEN | Drug Info | [3] | |||
| OLEIC ACID | Drug Info | [3] | |||
| Pathways | |||||
| KEGG Pathway | PPAR signaling pathway | ||||
| Fat digestion and absorption | |||||
| Reactome | Hormone-sensitive lipase (HSL)-mediated triacylglycerol hydrolysis | ||||
| PPARA activates gene expression | |||||
| Regulation of lipid metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha) | |||||
| WikiPathways | Nuclear Receptors Meta-Pathway | ||||
| PPAR Alpha Pathway | |||||
| Selenium Metabolism and Selenoproteins | |||||
| Regulation of Lipid Metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha) | |||||
| References | |||||
| REF 1 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2662). | ||||
| REF 2 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | ||||
| REF 3 | J Med Chem. 2008 Jul 10;51(13):3755-64. Epub 2008 Jun 6.Characterization of the drug binding specificity of rat liver fatty acid binding protein. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.