Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T72515
|
||||
Former ID |
TTDS00138
|
||||
Target Name |
Interleukin 1 receptor
|
||||
Gene Name |
IL1R1
|
||||
Synonyms |
IL-1R; IL1R1
|
||||
Target Type |
Successful
|
||||
Disease | Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06] | ||||
Function |
Receptor for IL1A, IL1B and IL1RN. After binding to interleukin-1 associates with the corecptor IL1RAP to form the high affinity interleukin-1 receptor complex which mediates interleukin-1-dependent activation of NF-kappa-B, MAPK and other pathways. Signaling involves the recruitment of adapter molecules such as TOLLIP, MYD88, and IRAK1 or IRAK2 via the respective TIR domains of the receptor/coreceptor subunits. Binds ligands with comparable affinity and binding of antagonist IL1RN prevents association with IL1RAP to form a signaling complex.
|
||||
BioChemical Class |
Immunoglobulin
|
||||
Target Validation |
T72515
|
||||
UniProt ID | |||||
Sequence |
MKVLLRLICFIALLISSLEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKD
DSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNL CYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDR LIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDL GSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISE IESRFYKHPFTCFAKNTHGIDAAYIQLIYPVTNFQKHMIGICVTLTVIIVCSVFIYKIFK IDIVLWYRDSCYDFLPIKASDGKTYDAYILYPKTVGEGSTSDCDIFVFKVLPEVLEKQCG YKLFIYGRDDYVGEDIVEVINENVKKSRRLIIILVRETSGFSWLGGSSEEQIAMYNALVQ DGIKVVLLELEKIQDYEKMPESIKFIKQKHGAIRWSGDFTQGPQSAKTRFWKNVRYHMPV QRRSPSSKHQLLSPATKEKLQREAHVPLG |
||||
Drugs and Mode of Action | |||||
Drug(s) | Anakinra | Drug Info | Approved | Rheumatoid arthritis | [1], [2] |
SB 203580 | Drug Info | Terminated | Discovery agent | [3], [4] | |
Antagonist | Anakinra | Drug Info | [5], [6] | ||
SB 203580 | Drug Info | [7] | |||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | MAPK signaling pathway | ||||
Cytokine-cytokine receptor interaction | |||||
NF-kappa B signaling pathway | |||||
Apoptosis | |||||
Osteoclast differentiation | |||||
Hematopoietic cell lineage | |||||
Inflammatory mediator regulation of TRP channels | |||||
Amoebiasis | |||||
HTLV-I infection | |||||
NetPath Pathway | TCR Signaling Pathway | ||||
IL2 Signaling Pathway | |||||
TGF_beta_Receptor Signaling Pathway | |||||
PANTHER Pathway | p38 MAPK pathway | ||||
Pathway Interaction Database | IL12-mediated signaling events | ||||
IL1-mediated signaling events | |||||
Reactome | Interleukin-1 signaling | ||||
WikiPathways | Monoamine Transport | ||||
Hypertrophy Model | |||||
MAPK Signaling Pathway | |||||
IL1 and megakaryotyces in obesity | |||||
Structural Pathway of Interleukin 1 (IL-1) | |||||
Spinal Cord Injury | |||||
Integrated Pancreatic Cancer Pathway | |||||
IL-1 signaling pathway | |||||
Interleukin-1 signaling | |||||
Apoptosis Modulation and Signaling | |||||
Serotonin Transporter Activity | |||||
References | |||||
REF 1 | Molecular targets of rheumatoid arthritis. Inflamm Allergy Drug Targets. 2008 Mar;7(1):53-66. | ||||
REF 2 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6972). | ||||
REF 3 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5269). | ||||
REF 4 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007147) | ||||
REF 5 | Complications and adverse reactions in the use of newer biologic agents. Semin Cutan Med Surg. 2007 Mar;26(1):6-14. | ||||
REF 6 | IL-1 receptor antagonism and muscle gene expression in patients with type 2 diabetes. Eur Cytokine Netw. 2009 Jun 1;20(2):81-87. | ||||
REF 7 | IL-1- and TNF-induced bone resorption is mediated by p38 mitogen activated protein kinase. J Cell Physiol. 2001 Jun;187(3):294-303. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.