Target General Infomation
Target ID
T37693
Former ID
TTDC00314
Target Name
Cannabinoid receptor 2
Gene Name
CNR2
Synonyms
CB-2; CB2; CX5; Cannabinoid CB2 receptor; CNR2
Target Type
Successful
Disease Atopic dermatitis [ICD9: 691.8, 692.9; ICD10: L00-L99]
Cerebrovascular ischaemia [ICD9: 434.91; ICD10: I61-I63]
Chemotherapy-induced nausea [ICD9: 787, 787.0; ICD10: R11]
Insomnia [ICD9: 307.41, 307.42, 327.0, 780.51, 780.52; ICD10: F51.0, G47.0]
Ischemia [ICD9: 459.89; ICD10: I99.8]
Inflammatory bowel disease [ICD9: 555, 556; ICD10: K50, K51]
Immune disorder [ICD10: D80-D89]
Inflammatory disease [ICD9: 140-229, 147, 173, 573.3, 710-719; ICD10: C11, C44, K75.9, M00-M25]
Lipid metabolism disorder [ICD10: E75-E78]
Neuropathic pain [ICD9: 356.0, 356.8; ICD10: G64, G90.0]
Osteoporosis [ICD9: 733.0, V07.4; ICD10: M80-M81, Z79.890]
Ovarian cancer [ICD9: 183; ICD10: C56]
Pain [ICD9: 338, 356.0, 356.8,780; ICD10: G64, G90.0, R52, G89]
Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06]
Function
Heterotrimeric G protein-coupled receptor for endocannabinoid 2-arachidonoylglycerol mediating inhibition of adenylate cyclase. May function in inflammatory response, nociceptive transmission and bone homeostasis.
BioChemical Class
GPCR rhodopsin
Target Validation
T37693
UniProt ID
Sequence
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
Drugs and Mode of Action
Drug(s) NABILONE Drug Info Approved Insomnia [551871]
Dronabinol oral solution Drug Info Phase 2/3 Chemotherapy-induced nausea [551036]
842166X Drug Info Phase 2 Pain [521980]
GW-42004 Drug Info Phase 2 Lipid metabolism disorder [549419]
KHK-6188 Drug Info Phase 2 Neuropathic pain [523813]
LY-2828360 Drug Info Phase 2 Pain [523404]
S-777469 Drug Info Phase 2 Atopic dermatitis [537075]
Tedalinab Drug Info Phase 1 Pain [548356]
Research programme: small molecule therapeutics, Boehringer Ingelheim Drug Info Preclinical Pain [548042]
KN-38-7271 Drug Info Discontinued in Phase 2 Ischemia [547265]
PRS-211375 iv Drug Info Discontinued in Phase 2 Pain [542484], [547996]
TAK-937 Drug Info Discontinued in Phase 1 Cerebrovascular ischaemia [548963]
AM-577 Drug Info Terminated Pain [547668]
PRS-639058 Drug Info Terminated Neuropathic pain [547996]
PXS-2076 Drug Info Terminated Rheumatoid arthritis [548079]
WIN-55212-2 Drug Info Terminated Discovery agent [542353], [545702]
Inhibitor (1R,2R)-N-Arachidonoylcyclopropanolamide Drug Info [530070]
(1R,2R)-N-Oleoylcyclopropanolamide Drug Info [530070]
(1R,2S)-N-Arachidonoylcyclopropanolamide Drug Info [530070]
(1R,2S)-N-Oleoylcyclopropanolamide Drug Info [530070]
(1S,2R)-N-Oleoylcyclopropanolamide Drug Info [530070]
(1S,2S)-N-Arachidonoylcyclopropanolamide Drug Info [530070]
(1S,2S)-N-Oleoylcyclopropanolamide Drug Info [530070]
(2R)-N-(6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-2,2-DIMETHYL-3,4-DIHYDRO-2H-PYRANO[2,3-B]PYRIDIN-4-YL)-2-HYDROXYPROPANAMIDE (ENANTIOMERIC MIX) Drug Info [530929]
(2R)-N-(7'-(2-CHLOROPHENYL)-6'-(4-CHLOROPHENYL)-3',4'-DIHYDROSPIRO[CYCLOHEXANE-1,2'-PYRANO[2,3-B]PYRIDINE]-4'-YL)-2-HYDROXYPROPANAMIDE (ENANTIOMERIC MIX) Drug Info [530929]
(2S)-N-(7'-(2-CHLOROPHENYL)-6'-(4-CHLOROPHENYL)-3',4'-DIHYDROSPIRO[CYCLOHEXANE-1,2'-PYRANO[2,3-B]PYRIDINE]-4'-YL)-2-HYDROXYPROPANAMIDE (ENANTIOMERIC MIX) Drug Info [530929]
(4-benzhydrylpiperazin-1-yl)(cyclohexyl)methanone Drug Info [530617]
(E)-N-(3,5-dimethoxyphenethyl)undec-2-enamide Drug Info [527788]
(E)-N-(4-methoxyphenethyl)undec-2-enamide Drug Info [527788]
(E)-N-(4-methoxyphenyl)undec-2-enamide Drug Info [527788]
1,4-dihydroindeno[1,2-c]-pyrazole Drug Info [527858]
2'-amino-4-(1,1-dimethyl-heptyl)-biphenyl-2-ol Drug Info [528844]
2-(2-Methoxybenzyl)-3H-benzo[f]chromen-3-one Drug Info [530009]
3'-amino-4-(1,1-dimethyl-heptyl)-biphenyl-2-ol Drug Info [528844]
3,4-diarylpyrazoline derivative Drug Info [527721]
3-benzoyl-1-pentyl-1,4-dihydroquinolin-4-one Drug Info [529079]
3-Benzyl-5-isopropyl-8-methylchromen-2-one Drug Info [530009]
4'-(1,1-dimethyl-heptyl)-3,5-dimethyl-biphenyl Drug Info [528844]
4'-amino-4-(1,1-dimethyl-heptyl)-biphenyl-2-ol Drug Info [528844]
4-(1,1-dimethyl-heptyl)-2'-methoxy-biphenyl-2-ol Drug Info [528844]
4-(1,1-dimethyl-heptyl)-3'-methoxy-biphenyl-2-ol Drug Info [528844]
4-benzhydryl-N-butylpiperazine-1-carboxamide Drug Info [530617]
4-benzhydryl-N-cyclohexylpiperazine-1-carboxamide Drug Info [530617]
5-(1,1-dimethyl-heptyl)-2-pyridin-3-yl-phenol Drug Info [528844]
5-Biphenyl-4-ylmethyl-1-isobutyl-1H-tetrazole Drug Info [529434]
5-Biphenyl-4-ylmethyl-2-isobutyl-2H-tetrazole Drug Info [529434]
5-Methoxy-3-(2-methoxybenzyl)-2H-chromen-2-one Drug Info [530009]
6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-2,2-DIMETHYL-3,4-DIHYDRO-2H-PYRANO[2,3-B]PYRIDINE-4-CARBOXAMIDE (ENANTIOMERIC MIX) Drug Info [530929]
6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-N-((R)-1-HYDROXYETHYL)-1,2,2-TRIMETHYL-1,2,3,4-TETRAHYDRO-1,8-NAPHTHYRIDINE-4-CARBOXAMIDE (ENANTIOMERIC MIX) Drug Info [530929]
6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-N-(1-HYDROXY-2-METHYLPROPAN-2-YL)-2,2-DIMETHYL-3,4-DIHYDRO-2H-PYRANO[2,3-B]PYRIDINE-4-CARBOXAMIDE (ENANTIOMERIC MIX) Drug Info [530929]
6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-N-(HYDROXYMETHYL)-1,2,2-TRIMETHYL-1,2,3,4-TETRAHYDRO-1,8-NAPHTHYRIDINE-4-CARBOXAMIDE (ENANTIOMERIC MIX) Drug Info [530929]
A-796260 Drug Info [530525]
AM-1241 Drug Info [530525]
AM-1710 Drug Info [529170]
AM-1714 Drug Info [529170]
AM-1715 Drug Info [529170]
AM-281 Drug Info [530009]
AM-404 Drug Info [529838]
AM-411 Drug Info [531004]
AM-4768 Drug Info [529170]
AM-630 Drug Info [529106]
Cis-N-oleoylcyclopropanolamide Drug Info [530070]
CP-55940 Drug Info [528562]
DELTA 8-TETRAHYDROCANNOBINOL Drug Info [529727]
Dodeca-2E,4E-dienoic acid isobutylamide Drug Info [528831]
GNF-PF-5188 Drug Info [529920]
JWH-120 Drug Info [529920]
JWH-133 Drug Info [528452]
JWH-145 Drug Info [528355]
JWH-146 Drug Info [528355]
JWH-147 Drug Info [528355]
JWH-150 Drug Info [528355]
JWH-151 Drug Info [529920]
JWH-156 Drug Info [528355]
JWH-167 Drug Info [527630]
JWH-201 Drug Info [527630]
JWH-202 Drug Info [527630]
JWH-203 Drug Info [527630]
JWH-204 Drug Info [527630]
JWH-205 Drug Info [527630]
JWH-206 Drug Info [527630]
JWH-207 Drug Info [527630]
JWH-208 Drug Info [527630]
JWH-209 Drug Info [527630]
JWH-229 Drug Info [529920]
JWH-237 Drug Info [527630]
JWH-243 Drug Info [528355]
JWH-244 Drug Info [528355]
JWH-245 Drug Info [528355]
JWH-246 Drug Info [528355]
JWH-248 Drug Info [527630]
JWH-249 Drug Info [527630]
JWH-250 Drug Info [527630]
JWH-251 Drug Info [527630]
JWH-252 Drug Info [527630]
JWH-253 Drug Info [527630]
JWH-268 Drug Info [529920]
JWH-292 Drug Info [528355]
JWH-293 Drug Info [528355]
JWH-294 Drug Info [529084]
JWH-295 Drug Info [529084]
JWH-296 Drug Info [529084]
JWH-297 Drug Info [529084]
JWH-302 Drug Info [527630]
JWH-303 Drug Info [527630]
JWH-305 Drug Info [527630]
JWH-306 Drug Info [527630]
JWH-307 Drug Info [528355]
JWH-308 Drug Info [528355]
JWH-309 Drug Info [528355]
JWH-311 Drug Info [527630]
JWH-312 Drug Info [527630]
JWH-313 Drug Info [527630]
JWH-314 Drug Info [527630]
JWH-315 Drug Info [527630]
JWH-323 Drug Info [529084]
JWH-324 Drug Info [531027]
JWH-325 Drug Info [529084]
JWH-337 Drug Info [529084]
JWH-342 Drug Info [529084]
JWH-343 Drug Info [529084]
JWH-344 Drug Info [529084]
JWH-345 Drug Info [529084]
JWH-346 Drug Info [528355]
JWH-347 Drug Info [528355]
JWH-348 Drug Info [528355]
JWH-363 Drug Info [528355]
JWH-364 Drug Info [528355]
JWH-365 Drug Info [528355]
JWH-366 Drug Info [528355]
JWH-367 Drug Info [528355]
JWH-368 Drug Info [528355]
JWH-369 Drug Info [528355]
JWH-370 Drug Info [528355]
JWH-371 Drug Info [528355]
JWH-372 Drug Info [528355]
JWH-373 Drug Info [528355]
JWH-385 Drug Info [529084]
JWH-392 Drug Info [529084]
JWH-401 Drug Info [529084]
JWH-402 Drug Info [529084]
JWH-403 Drug Info [529084]
JWH-404 Drug Info [529084]
JWH-405 Drug Info [529084]
JWH-406 Drug Info [529084]
JWH-407 Drug Info [529084]
JWH-440 Drug Info [531027]
JWH-441 Drug Info [531027]
JWH-442 Drug Info [531027]
KM-233 Drug Info [529515]
KM-233-M Drug Info [529515]
N-(1H-indazol-5-yl)icosa-5,8,11,14-tetraenamide Drug Info [529838]
N-(2-chloroethyl)icosa-5,8,11,14-tetraenamide Drug Info [529106]
N-(3,3-Diphenyl)propyl-2,2-diphenylacetamide Drug Info [529563]
N-(3-Phenyl)propyl-2-(4-bromophenylacetamide) Drug Info [529563]
N-(4-hydroxybenzyl)icosa-5,8,11,14-tetraenamide Drug Info [529838]
N-(6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-2,2-DIMETHYL-3,4-DIHYDRO-2H-PYRANO[2,3-B]PYRIDIN-4-YL)-2-HYDROXYACETAMIDE (ENANTIOMERIC MIX) Drug Info [530929]
N-(6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-2,2-DIMETHYL-3,4-DIHYDRO-2H-PYRANO[2,3-B]PYRIDIN-4-YL)-3-HYDROXY-2,2-DIMETHYLPROPANAMIDE (ENANTIOMERIC MIX) Drug Info [530929]
N-(6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-2,2-DIMETHYL-3,4-DIHYDRO-2H-PYRANO[2,3-B]PYRIDIN-4-YL)-3-HYDROXYPROPANAMIDE (ENANTIOMERIC MIX) Drug Info [530929]
N-(7'-(2-CHLOROPHENYL)-6'-(4-CHLOROPHENYL)-3',4'-DIHYDROSPIRO[CYCLOHEXANE-1,2'-PYRANO[2,3-B]PYRIDINE]-4'-YL)-2-HYDROXY-2-METHYLPROPANAMIDE (ENANTIOMERIC MIX) Drug Info [530929]
N-(7-(2-CHLOROPHENYL)-6-(4-CHLOROPHENYL)-2,2-DIMETHYL-3,4-DIHYDRO-2H-PYRANO[2,3-B]PYRIDIN-4-YL)-2-HYDROXYACETAMIDE (ENANTIOMERIC MIX) Drug Info [530929]
N-arachidonoyl-N-(2-hydroxyethyl)hydroxylamine Drug Info [528112]
N-arachidonoyl-O-(2-hydroxyethyl)hydroxylamine Drug Info [528112]
N-benzyl-4-bromo-3-(morpholinosulfonyl)benzamide Drug Info [529872]
N-oleoyl-N-(2-hydroxyethyl)hydroxylamine Drug Info [528112]
N-oleoyl-O-(2-hydroxyethyl)hydroxylamine Drug Info [528112]
N-[6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-2,2-DIMETHYL-3,4-DIHYDRO-2H-PYRANO[2,3-B]PYRIDINE-4-YL]-4,4,4-TRIFLUORO-3-HYDROXYBUTANAMIDE (DIASTEREOMERIC MIX) Drug Info [530871]
N1-(4-bromophenyl)-N2,N2-dipentylphthalamide Drug Info [529920]
NABILONE Drug Info [531196]
NAPHTHYRIDINONE Drug Info [527839]
O-arachidonoyl-N-(2-hydroxyethyl)hydroxylamine Drug Info [528112]
O-oleoyl-N-(2-hydroxyethyl)hydroxylamine Drug Info [528112]
PRAVADOLINE Drug Info [551296]
Rac-cis-N-arachidonoylcyclopropanolamide Drug Info [530070]
Rac-trans-N-oleoylcyclopropanolamide Drug Info [530070]
SCH-225336 Drug Info [530693]
SCH-356036 Drug Info [530597]
VER-156084 Drug Info [530200]
VER-156085 Drug Info [530200]
WIN-55212-2 Drug Info [528907]
Agonist 842166X Drug Info [532597]
AM-577 Drug Info [547669]
AR-XYZ Drug Info [543878]
JWH-015 Drug Info [536731]
JWH-051 Drug Info [543878]
KHK-6188 Drug Info [551579]
L-759,633 Drug Info [543878]
L-759,656 Drug Info [543878]
LY-2828360 Drug Info [551579]
MDA-19 Drug Info [543878]
Palmitoylethanolamide Drug Info [536731]
PRS-211375 iv Drug Info [544411]
PRS-639058 Drug Info [544486]
PXS-2076 Drug Info [543878]
Research programme: small molecule therapeutics, Boehringer Ingelheim Drug Info [543878]
RQ-00202730 Drug Info [543878]
S-777469 Drug Info [537075]
Sch-036 Drug Info [543878]
Tedalinab Drug Info [551201]
[3H]CP55940 Drug Info [534133]
[3H]HU-243 Drug Info [533602]
[3H]WIN55212-2 Drug Info [533680]
Modulator Delta-9-tetrahydrocannabinol prodrugs Drug Info [543878]
Dronabinol oral solution Drug Info [1572591]
GW-42004 Drug Info
KN-38-7271 Drug Info
TAK-937 Drug Info [531715]
Activator HU-433 Drug Info [543878]
Antagonist SR144528 Drug Info [535198]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway Neuroactive ligand-receptor interaction
Reactome Class A/1 (Rhodopsin-like receptors)
G alpha (i) signalling events
WikiPathways GPCRs, Class A Rhodopsin-like
Small Ligand GPCRs
GPCR ligand binding
GPCR downstream signaling
References
Ref 521980ClinicalTrials.gov (NCT00444769) Dental Pain 3rd Molar Tooth Extraction GW842166. U.S. National Institutes of Health.
Ref 523404ClinicalTrials.gov (NCT01319929) A Study of LY2828360 in Patients With Osteoarthritic Knee Pain. U.S. National Institutes of Health.
Ref 523813ClinicalTrials.gov (NCT01544296) A Comparative Study of KHK6188. U.S. National Institutes of Health.
Ref 537075Emerging drugs for atopic dermatitis. Expert Opin Emerg Drugs. 2009 Mar;14(1):165-79.
Ref 542353(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 733).
Ref 542484(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 746).
Ref 545702Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004262)
Ref 547265Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800014615)
Ref 547668Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018288)
Ref 547996Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800021026)
Ref 548042Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800021465)
Ref 548079Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800021746)
Ref 548356Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800024918)
Ref 548963Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800030875)
Ref 549419Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800036909)
Ref 551036Clinical pipeline report, company report or official report of INSYS Therapeutics.
Ref 551871Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
Ref
Ref 527630Bioorg Med Chem Lett. 2005 Sep 15;15(18):4110-3.1-Pentyl-3-phenylacetylindoles, a new class of cannabimimetic indoles.
Ref 527721Bioorg Med Chem Lett. 2005 Nov 1;15(21):4794-8.Novel 3,4-diarylpyrazolines as potent cannabinoid CB1 receptor antagonists with lower lipophilicity.
Ref 527788Bioorg Med Chem Lett. 2006 Jan 1;16(1):138-41. Epub 2005 Oct 6.New metabolically stable fatty acid amide ligands of cannabinoid receptors: Synthesis and receptor affinity studies.
Ref 527839Bioorg Med Chem Lett. 2006 Feb;16(3):681-5. Epub 2005 Nov 2.Synthesis of functionalized 1,8-naphthyridinones and their evaluation as novel, orally active CB1 receptor inverse agonists.
Ref 527858J Med Chem. 2005 Nov 17;48(23):7351-62.Tricyclic pyrazoles. 3. Synthesis, biological evaluation, and molecular modeling of analogues of the cannabinoid antagonist 8-chloro-1-(2',4'-dichlorophenyl)-N-piperidin-1-yl-1,4,5,6-tetrahydrobenzo[6,7]cyclohepta[1,2-c]pyrazole-3-carboxamide.
Ref 528112J Med Chem. 2006 Apr 6;49(7):2333-8.Oxyhomologues of anandamide and related endolipids: chemoselective synthesis and biological activity.
Ref 528355Bioorg Med Chem Lett. 2006 Oct 15;16(20):5432-5. Epub 2006 Aug 4.1-Alkyl-2-aryl-4-(1-naphthoyl)pyrroles: new high affinity ligands for the cannabinoid CB1 and CB2 receptors.
Ref 528452J Med Chem. 2006 Oct 5;49(20):5947-57.Design, synthesis, and biological evaluation of new 1,8-naphthyridin-4(1H)-on-3-carboxamide and quinolin-4(1H)-on-3-carboxamide derivatives as CB2 selective agonists.
Ref 528562J Med Chem. 2006 Dec 14;49(25):7502-12.Tricyclic pyrazoles. 4. Synthesis and biological evaluation of analogues of the robust and selective CB2 cannabinoid ligand 1-(2',4'-dichlorophenyl)-6-methyl-N-piperidin-1-yl-1,4-dihydroindeno[1,2-c]pyrazole-3-carboxamide.
Ref 528831J Nat Prod. 2007 Jun;70(6):1010-5. Epub 2007 May 11.Self-assembling cannabinomimetics: supramolecular structures of N-alkyl amides.
Ref 528844Bioorg Med Chem Lett. 2007 Jul 1;17(13):3652-6. Epub 2007 Apr 25.Biaryl cannabinoid mimetics--synthesis and structure-activity relationship.
Ref 528907Eur J Med Chem. 2008 Mar;43(3):513-39. Epub 2007 May 6.Synthesis and cannabinoid activity of 1-substituted-indole-3-oxadiazole derivatives: novel agonists for the CB1 receptor.
Ref 529079J Med Chem. 2007 Nov 1;50(22):5471-84. Epub 2007 Oct 4.Pharmacomodulations around the 4-oxo-1,4-dihydroquinoline-3-carboxamides, a class of potent CB2-selective cannabinoid receptor ligands: consequences in receptor affinity and functionality.
Ref 529084Bioorg Med Chem. 2008 Jan 1;16(1):322-35. Epub 2007 Sep 22.Synthesis and pharmacology of 1-deoxy analogs of CP-47,497 and CP-55,940.
Ref 529106Bioorg Med Chem Lett. 2007 Dec 1;17(23):6505-10. Epub 2007 Oct 1.New 1,8-naphthyridine and quinoline derivatives as CB2 selective agonists.
Ref 529170J Med Chem. 2007 Dec 27;50(26):6493-500. Epub 2007 Nov 27.Cannabilactones: a novel class of CB2 selective agonists with peripheral analgesic activity.
Ref 529434Bioorg Med Chem Lett. 2008 May 1;18(9):2820-4. Epub 2008 Apr 4.New tetrazole-based selective anandamide uptake inhibitors.
Ref 529515Bioorg Med Chem. 2008 Jul 1;16(13):6489-500. Epub 2008 May 20.Exploring the substituent effects on a novel series of C1'-dimethyl-aryl Delta8-tetrahydrocannabinol analogs.
Ref 529563Bioorg Med Chem. 2008 Aug 1;16(15):7510-5. Epub 2008 Jun 7.Novel sterically hindered cannabinoid CB1 receptor ligands.
Ref 529727J Med Chem. 2008 Oct 23;51(20):6393-9. Epub 2008 Oct 1.Bornyl- and isobornyl-Delta8-tetrahydrocannabinols: a novel class of cannabinergic ligands.
Ref 529838J Med Chem. 2008 Dec 25;51(24):7800-5.New analgesics synthetically derived from the paracetamol metabolite N-(4-hydroxyphenyl)-(5Z,8Z,11Z,14Z)-icosatetra-5,8,11,14-enamide.
Ref 529872Bioorg Med Chem Lett. 2009 Jan 15;19(2):309-13. Epub 2008 Nov 27.CB2 selective sulfamoyl benzamides: optimization of the amide functionality.
Ref 529920J Med Chem. 2009 Jan 22;52(2):369-78.Discovery of novel CB2 receptor ligands by a pharmacophore-based virtual screening workflow.
Ref 530009Bioorg Med Chem. 2009 Apr 1;17(7):2842-51. Epub 2009 Feb 21.Synthesis and pharmacological evaluation of coumarin derivatives as cannabinoid receptor antagonists and inverse agonists.
Ref 530070J Med Chem. 2009 May 14;52(9):3001-9.Conformationally constrained fatty acid ethanolamides as cannabinoid and vanilloid receptor probes.
Ref 530200Bioorg Med Chem Lett. 2009 Aug 1;19(15):4241-4. Epub 2009 May 29.Fatty acid amide hydrolase inhibitors. Surprising selectivity of chiral azetidine ureas.
Ref 530525J Med Chem. 2010 Jan 14;53(1):295-315.Indol-3-ylcycloalkyl ketones: effects of N1 substituted indole side chain variations on CB(2) cannabinoid receptor activity.
Ref 530597Bioorg Med Chem Lett. 2010 Feb 1;20(3):1084-9. Epub 2009 Dec 11.Synthesis and SAR of novel imidazoles as potent and selective cannabinoid CB2 receptor antagonists with high binding efficiencies.
Ref 530617Eur J Med Chem. 2010 Mar;45(3):1133-9. Epub 2009 Dec 16.Discovery of benzhydrylpiperazine derivatives as CB1 receptor inverse agonists via privileged structure-based approach.
Ref 530693Bioorg Med Chem Lett. 2010 Mar 1;20(5):1565-8. Epub 2010 Jan 21.Radiosynthesis of novel carbon-11-labeled triaryl ligands for cannabinoid-type 2 receptor.
Ref 530871J Med Chem. 2010 May 27;53(10):4028-37.Discovery of N-[(4R)-6-(4-chlorophenyl)-7-(2,4-dichlorophenyl)-2,2-dimethyl-3,4-dihydro-2H-pyrano[2,3-b]pyridin-4-yl]-5-methyl-1H-pyrazole-3-carboxamide (MK-5596) as a novel cannabinoid-1 receptor (CB1R) inverse agonist for the treatment of obesity.
Ref 530929Bioorg Med Chem Lett. 2010 Jun 15;20(12):3750-4. Epub 2010 Apr 21.Dihydro-pyrano[2,3-b]pyridines and tetrahydro-1,8-naphthyridines as CB1 receptor inverse agonists: synthesis, SAR and biological evaluation.
Ref 531004J Med Chem. 2010 Aug 12;53(15):5656-66.Heteroadamantyl cannabinoids.
Ref 531027Bioorg Med Chem. 2010 Aug 1;18(15):5475-82. Epub 2010 Jun 22.Synthesis and pharmacology of 1-methoxy analogs of CP-47,497.
Ref 531196J Med Chem. 2010 Oct 14;53(19):6996-7010.Novel 1',1'-chain substituted hexahydrocannabinols: 9|A-hydroxy-3-(1-hexyl-cyclobut-1-yl)-hexahydrocannabinol (AM2389) a highly potent cannabinoid receptor 1 (CB1) agonist.
Ref 531715Cerebroprotective effects of TAK-937, a cannabinoid receptor agonist, on ischemic brain damage in middle cerebral artery occluded rats and non-human primates. Brain Res. 2012 Jan 9;1430:93-100.
Ref 532597The agonist binding mechanism of human CB2 receptor studied by molecular dynamics simulation, free energy calculation and 3D-QSAR studies. Yao Xue Xue Bao. 2013 Sep;48(9):1436-49.
Ref 533602The peripheral cannabinoid receptor: adenylate cyclase inhibition and G protein coupling. FEBS Lett. 1995 Nov 13;375(1-2):143-7.
Ref 533680Activation of the human peripheral cannabinoid receptor results in inhibition of adenylyl cyclase. Mol Pharmacol. 1995 Aug;48(2):352-61.
Ref 534133Signaling pathway associated with stimulation of CB2 peripheral cannabinoid receptor. Involvement of both mitogen-activated protein kinase and induction of Krox-24 expression. Eur J Biochem. 1996 May1;237(3):704-11.
Ref 535198Antinociceptive activity of the endogenous fatty acid amide, palmitylethanolamide. Eur J Pharmacol. 2001 May 11;419(2-3):191-8.
Ref 536731Posttraining activation of CB1 cannabinoid receptors in the CA1 region of the dorsal hippocampus impairs object recognition long-term memory. Neurobiol Learn Mem. 2008 Sep;90(2):374-81. Epub 2008 Jun 3.
Ref 537075Emerging drugs for atopic dermatitis. Expert Opin Emerg Drugs. 2009 Mar;14(1):165-79.
Ref 543878(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 57).
Ref 544411Brain CB2 Receptors: Implications for Neuropsychiatric Disorders. Pharmaceuticals (Basel) 2010 August; 3(8): 2517-2553.
Ref 544486Targeting CB2 receptors and the endocannabinoid system for the treatment of pain. Brain Res Rev. 2009 April; 60(1): 255-266.
Ref 547669Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018288)
Ref 551201Cannabinoid CB2 receptor (CNR2). SciBX 3(46); doi:10.1038/scibx.2010.1384. Dec. 2 2010
Ref 551296Morpholinoalkylindenes as antinociceptive agents: Novel cannabinoid receptor agonists, Bioorg. Med. Chem. Lett. 5(4):381-386 (1995).
Ref 551579Recent Development of CB2 Selective and Peripheral CB1/CB2 Cannabinoid Receptor Ligands. Current Medicinal Chemistry . 10/2013; 21(2).
Ref 1572591Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.