Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T30823
|
||||
Former ID |
TTDR00202
|
||||
Target Name |
M-phase inducer phosphatase 1
|
||||
Gene Name |
CDC25A
|
||||
Synonyms |
Cdc25A phosphatase; Dual specificity phosphatase Cdc25A; CDC25A
|
||||
Target Type |
Discontinued
|
||||
Disease | Cancer [ICD9: 140-229; ICD10: C00-C96] | ||||
Function |
Tyrosine protein phosphatase which functions as a dosage-dependent inducer of mitotic progression. Directly dephosphorylates CDK1 and stimulates its kinase activity. Also dephosphorylates CDK2 incomplex with cyclin E, in vitro.
|
||||
BioChemical Class |
Phosphoric monoester hydrolases
|
||||
Target Validation |
T30823
|
||||
UniProt ID | |||||
EC Number |
EC 3.1.3.48
|
||||
Sequence |
MELGPEPPHRRRLLFACSPPPASQPVVKALFGASAAGGLSPVTNLTVTMDQLQGLGSDYE
QPLEVKNNSNLQRMGSSESTDSGFCLDSPGPLDSKENLENPMRRIHSLPQKLLGCSPALK RSHSDSLDHDIFQLIDPDENKENEAFEFKKPVRPVSRGCLHSHGLQEGKDLFTQRQNSAP ARMLSSNERDSSEPGNFIPLFTPQSPVTATLSDEDDGFVDLLDGENLKNEEETPSCMASL WTAPLVMRTTNLDNRCKLFDSPSLCSSSTRSVLKRPERSQEESPPGSTKRRKSMSGASPK ESTNPEKAHETLHQSLSLASSPKGTIENILDNDPRDLIGDFSKGYLFHTVAGKHQDLKYI SPEIMASVLNGKFANLIKEFVIIDCRYPYEYEGGHIKGAVNLHMEEEVEDFLLKKPIVPT DGKRVIVVFHCEFSSERGPRMCRYVRERDRLGNEYPKLHYPELYVLKGGYKEFFMKCQSY CEPPSYRPMHHEDFKEDLKKFRTKSRTWAGEKSKREMYSRLKKL |
||||
Drugs and Mode of Action | |||||
Drug(s) | MX-7065 | Drug Info | Terminated | Cancer | [1] |
Inhibitor | (E)-2-(1-decyl-2-oxoindolin-3-ylidene)acetic acid | Drug Info | [2] | ||
(Z)-2-(1-decyl-2-oxoindolin-3-ylidene)acetic acid | Drug Info | [2] | |||
1-dodecyl-1H-indole-2,3-dione | Drug Info | [2] | |||
2-(1-dodecyl-1H-indol-3-yl)acetic acid | Drug Info | [2] | |||
3-isopropyl-4-(phenylamino)naphthalene-1,2-dione | Drug Info | [3] | |||
3-isopropyl-4-(phenylthio)naphthalene-1,2-dione | Drug Info | [3] | |||
3-isopropyl-4-phenylnaphthalene-1,2-dione | Drug Info | [3] | |||
3-isopropylnaphthalene-1,2-dione | Drug Info | [3] | |||
4-(p-toluidino)-3-isopropylnaphthalene-1,2-dione | Drug Info | [3] | |||
MX-7065 | Drug Info | [4] | |||
Naphthoquinone analogs | Drug Info | [5] | |||
NSC-95397 | Drug Info | [6] | |||
Pathways | |||||
KEGG Pathway | Cell cycle | ||||
Progesterone-mediated oocyte maturation | |||||
MicroRNAs in cancer | |||||
NetPath Pathway | IL4 Signaling Pathway | ||||
TGF_beta_Receptor Signaling Pathway | |||||
Pathway Interaction Database | E2F transcription factor network | ||||
ATR signaling pathway | |||||
Validated targets of C-MYC transcriptional activation | |||||
ATM pathway | |||||
Reactome | E2F mediated regulation of DNA replication | ||||
G0 and Early G1 | |||||
Polo-like kinase mediated events | |||||
Cyclin B2 mediated events | |||||
Activation of ATR in response to replication stress | |||||
Cyclin E associated events during G1/S transition | |||||
G1/S-Specific Transcription | |||||
Cyclin A/B1 associated events during G2/M transition | |||||
Ubiquitin Mediated Degradation of Phosphorylated Cdc25A | |||||
Cdk2-associated events at S phase entry | |||||
WikiPathways | DNA Damage Response | ||||
G1 to S cell cycle control | |||||
S Phase | |||||
ATM Signaling Pathway | |||||
Retinoblastoma (RB) in Cancer | |||||
Prostate Cancer | |||||
Integrated Breast Cancer Pathway | |||||
Integrated Cancer pathway | |||||
Mitotic G1-G1/S phases | |||||
Cell Cycle | |||||
Cell Cycle Checkpoints | |||||
miRNAs involved in DNA damage response | |||||
miRNA Regulation of DNA Damage Response | |||||
References | |||||
REF 1 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800016615) | ||||
REF 2 | Bioorg Med Chem Lett. 2008 Jun 1;18(11):3350-3. Epub 2008 Apr 15.Design and synthesis of N-alkyl oxindolylidene acetic acids as a new class of potent Cdc25A inhibitors. | ||||
REF 3 | Bioorg Med Chem Lett. 2006 Apr 1;16(7):1905-8. Epub 2006 Jan 24.Synthesis of miltirone analogues as inhibitors of Cdc25 phosphatases. | ||||
REF 4 | Handbook of Assay Development in Drug Discovery, Lisa K. Minor, 2013. Page(11). | ||||
REF 5 | Role of the Cdc25A phosphatase in human breast cancer. J Clin Invest. 2000 Sep;106(6):753-61. | ||||
REF 6 | Bioorg Med Chem Lett. 2009 Aug 1;19(15):4330-4. Epub 2009 May 27.Structure-based de novo design and biochemical evaluation of novel Cdc25 phosphatase inhibitors. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.