Target Information

Target General Infomation
Target ID
T26203
Former ID
TTDI01933
Target Name
ICAM-1
Gene Name
ICAM1
Synonyms
CD54; Intercellular adhesion molecule 1; Major group rhinovirus receptor; ICAM1
Target Type
Clinical Trial
Disease Allergic conjunctivitis [ICD9: 204.0, 372.0, 372.14, 995.3; ICD10: C91.0, H10, H10.45, T78.4]
Hormone refractory prostate cancer [ICD9: 140-229, 185; ICD10: C61]
Inflammatory bowel disease [ICD9: 555, 556; ICD10: K50, K51]
Inflammatory disease [ICD9: 140-229, 147, 173, 573.3, 710-719; ICD10: C11, C44, K75.9, M00-M25]
Multiple myeloma [ICD9: 203; ICD10: C90]
Psoriasis [ICD9: 696; ICD10: L40]
Unspecified [ICD code not available]
Function
ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). During leukocyte trans- endothelial migration, ICAM1 engagement promotes the assembly of endothelial apical cups through ARHGEF26/SGEF and RHOG activation.In case of rhinovirus infection acts as a cellular receptor for the virus.
BioChemical Class
Immunoglobulin
UniProt ID
P05362
Sequence
MAPSSPRPALPALLVLLGALFPGPGNAQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGI
ETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAP
LPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHH
GANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLD
GLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQE
TLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKA
TPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQ
AWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE
IVIITVVAAAVIMGTAGLSTYLYNRQRKIKKYRLQQAQKGTPMKPNTQATPP
Drugs and Mode of Action
Drug(s) SAR-1118 Drug Info Phase 3 Allergic conjunctivitis [523596], [542538]
APC-8015F Drug Info Phase 2 Hormone refractory prostate cancer [522591]
BI-505 Drug Info Phase 1 Multiple myeloma [532319]
A-252444.0 Drug Info Terminated Inflammatory disease [547055]
GI-270384X Drug Info Terminated Inflammatory bowel disease [529903]
MOR-102 Drug Info Terminated Psoriasis [547549]
Antagonist A-252444.0 Drug Info [547056]
Modulator APC-8015F Drug Info [550416]
GI-270384X Drug Info [529903]
ISIS-1939 Drug Info
Inhibitor SAR-1118 Drug Info [532815]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway NF-kappa B signaling pathway
Cell adhesion molecules (CAMs)
Natural killer cell mediated cytotoxicity
TNF signaling pathway
Leukocyte transendothelial migration
African trypanosomiasis
Malaria
Staphylococcus aureus infection
Influenza A
HTLV-I infection
Epstein-Barr virus infection
Rheumatoid arthritis
Viral myocarditis
NetPath Pathway IL5 Signaling Pathway
IL1 Signaling Pathway
TSH Signaling Pathway
IL6 Signaling Pathway
IL2 Signaling Pathway
ID Signaling Pathway
TWEAK Signaling Pathway
RANKL Signaling Pathway
TNFalpha Signaling Pathway
Pathway Interaction Database Thromboxane A2 receptor signaling
Glucocorticoid receptor regulatory network
amb2 Integrin signaling
Beta2 integrin cell surface interactions
Reactome Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Integrin cell surface interactions
Interferon gamma signaling
WikiPathways Type II interferon signaling (IFNG)
IL1 and megakaryotyces in obesity
Human Complement System
Spinal Cord Injury
Interleukin-11 Signaling Pathway
RANKL/RANK Signaling Pathway
Integrin cell surface interactions
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Folate Metabolism
Vitamin B12 Metabolism
Selenium Micronutrient Network
References
Ref 522591ClinicalTrials.gov (NCT00849290) Immunotherapy For Men With Objective Disease Progression On Protocol D9902 Part B (NCT00065442). U.S. National Institutes of Health.
Ref 523596ClinicalTrials.gov (NCT01421498) Safety and Efficacy Study of SAR 1118 to Treat Dry Eye. U.S. National Institutes of Health.
Ref 529903Inhibition of endothelial cell adhesion molecule expression improves colonic hyperalgaesia. Neurogastroenterol Motil. 2009 Feb;21(2):189-96.
Ref 532319A human ICAM-1 antibody isolated by a function-first approach has potent macrophage-dependent antimyeloma activity in vivo. Cancer Cell. 2013 Apr 15;23(4):502-15.
Ref 542538(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7533).
Ref 547055Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800012566)
Ref 547549Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800017213)
Ref 527755Efficacy of the fully human monoclonal antibody MOR102 (#5) against intercellular adhesion molecule 1 in the psoriasis-severe combined immunodeficient mouse model. Br J Dermatol. 2005 Oct;153(4):758-66.
Ref 529903Inhibition of endothelial cell adhesion molecule expression improves colonic hyperalgaesia. Neurogastroenterol Motil. 2009 Feb;21(2):189-96.
Ref 532319A human ICAM-1 antibody isolated by a function-first approach has potent macrophage-dependent antimyeloma activity in vivo. Cancer Cell. 2013 Apr 15;23(4):502-15.
Ref 532815Discovery and Development of Potent LFA-1/ICAM-1 Antagonist SAR 1118 as an Ophthalmic Solution for Treating Dry Eye. ACS Med Chem Lett. 2012 Jan 31;3(3):203-6.
Ref 547056Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800012566)
Ref 550416National Cancer Institute Drug Dictionary (drug id 561410).

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.