Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T13259
|
||||
| Former ID |
TTDS00054
|
||||
| Target Name |
Succinate semialdehyde dehydrogenase, mitochondrial
|
||||
| Gene Name |
ALDH5A1
|
||||
| Synonyms |
NAD(+)-dependent succinic semialdehyde dehydrogenase; Succinic dehydrogenase; ALDH5A1
|
||||
| Target Type |
Successful
|
||||
| Disease | Dietary shortage [ICD9: 260-269; ICD10: E40-E46] | ||||
| Diagnostic imaging [ICD9: 331; ICD10: G30, I73.9] | |||||
| Function |
Catalyzes one step in the degradation of the inhibitory neurotransmitter gamma-aminobutyric acid (GABA).
|
||||
| BioChemical Class |
Oxidoreductases acting on aldehyde or oxo group of donors
|
||||
| Target Validation |
T13259
|
||||
| UniProt ID | |||||
| EC Number |
EC 1.2.1.24
|
||||
| Sequence |
MATCIWLRSCGARRLGSTFPGCRLRPRAGGLVPASGPAPGPAQLRCYAGRLAGLSAALLR
TDSFVGGRWLPAAATFPVQDPASGAALGMVADCGVREARAAVRAAYEAFCRWREVSAKER SSLLRKWYNLMIQNKDDLARIITAESGKPLKEAHGEILYSAFFLEWFSEEARRVYGDIIH TPAKDRRALVLKQPIGVAAVITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPFSALAL AELASQAGIPSGVYNVIPCSRKNAKEVGEAICTDPLVSKISFTGSTTTGKILLHHAANSV KRVSMELGGLAPFIVFDSANVDQAVAGAMASKFRNTGQTCVCSNQFLVQRGIHDAFVKAF AEAMKKNLRVGNGFEEGTTQGPLINEKAVEKVEKQVNDAVSKGATVVTGGKRHQLGKNFF EPTLLCNVTQDMLCTHEETFGPLAPVIKFDTEEEAIAIANAADVGLAGYFYSQDPAQIWR VAEQLEVGMVGVNEGLISSVECPFGGVKQSGLGREGSKYGIDEYLELKYVCYGGL |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Chlormerodrin | Drug Info | Approved | Diagnostic imaging | [1] |
| Succinic acid | Drug Info | Approved | Dietary shortage | [2], [3] | |
| Inhibitor | 1-(4-hydroxyphenyl)prop-2-en-1-one | Drug Info | [4] | ||
| Succinic acid | Drug Info | [5], [6], [7] | |||
| VANILLIN | Drug Info | [4] | |||
| Modulator | Chlormerodrin | Drug Info | [8] | ||
| Pathways | |||||
| BioCyc Pathway | GABA shunt | ||||
| 4-aminobutyrate degradation | |||||
| KEGG Pathway | Alanine, aspartate and glutamate metabolism | ||||
| Butanoate metabolism | |||||
| Metabolic pathways | |||||
| PANTHER Pathway | Aminobutyrate degradation | ||||
| Gamma-aminobutyric acid synthesis | |||||
| PathWhiz Pathway | Glutamate Metabolism | ||||
| WikiPathways | GABA synthesis, release, reuptake and degradation | ||||
| References | |||||
| REF 1 | Drug information of Chlormerodrin, 2008. eduDrugs. | ||||
| REF 2 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3637). | ||||
| REF 3 | Handbook of Food Analysis: Residues and other food component analysis. 2006, P914. By Leo M. L. Nollet. | ||||
| REF 4 | Bioorg Med Chem Lett. 2006 Feb;16(3):592-5. Epub 2005 Nov 14.Inhibition of GABA shunt enzymes' activity by 4-hydroxybenzaldehyde derivatives. | ||||
| REF 5 | The GABA shunt: an attractive and potential therapeutic target in the treatment of epileptic disorders. Curr Drug Metab. 2005 Apr;6(2):127-39. | ||||
| REF 6 | Succinic semialdehyde couples stress response to quorum-sensing signal decay in Agrobacterium tumefaciens. Mol Microbiol. 2006 Oct;62(1):45-56. Epub 2006 Aug 30. | ||||
| REF 7 | Redox-switch modulation of human SSADH by dynamic catalytic loop. EMBO J. 2009 Apr 8;28(7):959-68. Epub 2009 Mar 19. | ||||
| REF 8 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.