Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T03818
|
||||
Former ID |
TTDR01386
|
||||
Target Name |
mRNA of PPAR-gamma
|
||||
Gene Name |
PPARG
|
||||
Synonyms |
Nuclear receptor subfamily 1 group C member 3 (mRNA); PPARG (mRNA); PPARgamma (mRNA); Peroxisome proliferatoractivated receptor gamma (mRNA); PPARG
|
||||
Target Type |
Research
|
||||
BioChemical Class |
Nuclear hormone receptor
|
||||
Target Validation |
T03818
|
||||
UniProt ID | |||||
Sequence |
MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTEMPFWPTNFGISSVDLSVMEDHSHSF
DIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKT QLYNKPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNC RIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLR ALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQE QSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLAS LMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVII LSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQL LQVIKKTETDMSLHPLLQEIYKDLY |
||||
Inhibitor | (9Z,12E)-12-nitrooctadeca-9,12-dienoic acid | Drug Info | [530350] | ||
(E)-10-Nitrohexadec-9-enoic Acid | Drug Info | [530350] | |||
(E)-10-nitrooctadec-9-enoic acid | Drug Info | [530350] | |||
(E)-12-Nitrooctadec-12-enoic Acid | Drug Info | [530350] | |||
(E)-13-Nitrooctadec-12-enoic Acid | Drug Info | [530350] | |||
(E)-5-Nitrooctadec-5-enoic Acid | Drug Info | [530350] | |||
(E)-6-Nitrooctadec-5-enoic Acid | Drug Info | [530350] | |||
(E)-9-Nitrohexadec-9-enoicAcid | Drug Info | [530350] | |||
(E)-9-nitrooctadec-9-enoic acid | Drug Info | [530350] | |||
2-chloro-5-nitro-N-(pyridin-4-yl)benzamide | Drug Info | [529363] | |||
BRL-48482 | Drug Info | [551304] | |||
CHLOROCYCLINONE A | Drug Info | [529182] | |||
CHLOROCYCLINONE B | Drug Info | [529182] | |||
CHLOROCYCLINONE C | Drug Info | [529182] | |||
CHLOROCYCLINONE D | Drug Info | [529182] | |||
GNF-PF-2893 | Drug Info | [531262] | |||
GNF-PF-3037 | Drug Info | [531262] | |||
GW-9662 | Drug Info | [529363] | |||
L-165461 | Drug Info | [526582] | |||
L-796449 | Drug Info | [526582] | |||
L-Tryptophan-L-2-aminoadipic acid | Drug Info | [529363] | |||
L-Tryptophan-L-arginine | Drug Info | [529363] | |||
L-Tryptophan-L-asparagine | Drug Info | [529363] | |||
L-Tryptophan-L-aspartic acid | Drug Info | [529363] | |||
L-Tryptophan-L-glutamine | Drug Info | [529363] | |||
L-Tryptophan-L-leucine | Drug Info | [529363] | |||
PD-068235 | Drug Info | [529363] | |||
PLOGLITAZONE | Drug Info | [527158] | |||
SB-213068 | Drug Info | [551304] | |||
Agonist | AD-5061 | Drug Info | [527124] | ||
BADGE | Drug Info | [525678] | |||
COOH | Drug Info | [526520] | |||
DRF 2519 | Drug Info | [527076] | |||
FMOC-L-Leucine | Drug Info | [526183] | |||
GW0072 | Drug Info | [525499] | |||
GW1929 | Drug Info | [525528] | |||
L-764406 | Drug Info | [525436] | |||
L-783483 | Drug Info | [525425] | |||
LG100754 | Drug Info | [526284] | |||
LY-465608 | Drug Info | [526080] | |||
MRL20 | Drug Info | [527337] | |||
MRL24 | Drug Info | [527337] | |||
nTzDpa | Drug Info | [526526] | |||
PAT5A | Drug Info | [525920] | |||
reglitazar | Drug Info | [534829] | |||
tagitinin A | Drug Info | [531847] | |||
tirotundin | Drug Info | [531847] | |||
TZD18 | Drug Info | [526920] | |||
[125I]SB-236636 | Drug Info | [534550] | |||
[3H]AD5075 | Drug Info | [534222] | |||
[3H]GW2331 | Drug Info | [534367] | |||
Antagonist | CDDO-Me | Drug Info | [525892] | ||
T0070907 | Drug Info | [526285] | |||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
DRM | DRM Info | ||||
Pathways | |||||
KEGG Pathway | PPAR signaling pathway | ||||
AMPK signaling pathway | |||||
Osteoclast differentiation | |||||
Huntington' | |||||
s disease | |||||
Pathways in cancer | |||||
Transcriptional misregulation in cancer | |||||
Thyroid cancer | |||||
NetPath Pathway | IL1 Signaling Pathway | ||||
TGF_beta_Receptor Signaling Pathway | |||||
Leptin Signaling Pathway | |||||
PANTHER Pathway | CCKR signaling map ST | ||||
Pathway Interaction Database | Noncanonical Wnt signaling pathway | ||||
Calcineurin-regulated NFAT-dependent transcription in lymphocytes | |||||
Signaling events mediated by HDAC Class I | |||||
RXR and RAR heterodimerization with other nuclear receptor | |||||
Regulation of retinoblastoma protein | |||||
Reactome | PPARA activates gene expression | ||||
Transcriptional regulation of white adipocyte differentiation | |||||
Nuclear Receptor transcription pathway | |||||
WikiPathways | Wnt Signaling Pathway Netpath | ||||
Nuclear Receptors in Lipid Metabolism and Toxicity | |||||
Differentiation of white and brown adipocyte | |||||
Regulation of Lipid Metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha) | |||||
Transcriptional Regulation of White Adipocyte Differentiation | |||||
Adipogenesis | |||||
SREBP signalling | |||||
Nuclear Receptors | |||||
References | |||||
Ref 525425 | Novel peroxisome proliferator-activated receptor (PPAR) gamma and PPARdelta ligands produce distinct biological effects. J Biol Chem. 1999 Mar 5;274(10):6718-25. | ||||
Ref 525436 | L-764406 is a partial agonist of human peroxisome proliferator-activated receptor gamma. The role of Cys313 in ligand binding. J Biol Chem. 1999 Mar 19;274(12):7913-22. | ||||
Ref 525499 | A peroxisome proliferator-activated receptor gamma ligand inhibits adipocyte differentiation. Proc Natl Acad Sci U S A. 1999 May 25;96(11):6102-6. | ||||
Ref 525528 | A novel N-aryl tyrosine activator of peroxisome proliferator-activated receptor-gamma reverses the diabetic phenotype of the Zucker diabetic fatty rat. Diabetes. 1999 Jul;48(7):1415-24. | ||||
Ref 525678 | A synthetic antagonist for the peroxisome proliferator-activated receptor gamma inhibits adipocyte differentiation. J Biol Chem. 2000 Jan 21;275(3):1873-7. | ||||
Ref 525892 | A synthetic triterpenoid, 2-cyano-3,12-dioxooleana-1,9-dien-28-oic acid (CDDO), is a ligand for the peroxisome proliferator-activated receptor gamma. Mol Endocrinol. 2000 Oct;14(10):1550-6. | ||||
Ref 525920 | Euglycemic and hypolipidemic activity of PAT5A: a unique thiazolidinedione with weak peroxisome proliferator activated receptor gamma activity. Metabolism. 2000 Nov;49(11):1417-23. | ||||
Ref 526080 | Design and synthesis of 2-methyl-2-[4-(2-[5-methyl-2-aryloxazol-4-yl]ethoxy)phenoxy]propionic acids: a new class of dual PPARalpha/gamma agonists. J Med Chem. 2001 Jun 21;44(13):2061-4. | ||||
Ref 526183 | A unique PPARgamma ligand with potent insulin-sensitizing yet weak adipogenic activity. Mol Cell. 2001 Oct;8(4):737-47. | ||||
Ref 526284 | The antidiabetic agent LG100754 sensitizes cells to low concentrations of peroxisome proliferator-activated receptor gamma ligands. J Biol Chem. 2002 Apr 12;277(15):12503-6. Epub 2002 Feb 27. | ||||
Ref 526285 | T0070907, a selective ligand for peroxisome proliferator-activated receptor gamma, functions as an antagonist of biochemical and cellular activities. J Biol Chem. 2002 May 31;277(22):19649-57. Epub 2002 Mar 4. | ||||
Ref 526520 | PPAR-gamma activation mediates adipose depot-specific effects on gene expression and lipoprotein lipase activity: mechanisms for modulation of postprandial lipemia and differential adipose accretion.Diabetes. 2003 Feb;52(2):291-9. | ||||
Ref 526526 | Distinct properties and advantages of a novel peroxisome proliferator-activated protein [gamma] selective modulator. Mol Endocrinol. 2003 Apr;17(4):662-76. Epub 2003 Jan 16. | ||||
Ref 526582 | Bioorg Med Chem Lett. 2003 Apr 7;13(7):1277-80.Phenylacetic acid derivatives as hPPAR agonists. | ||||
Ref 526920 | A novel peroxisome proliferator-activated receptor alpha/gamma dual agonist demonstrates favorable effects on lipid homeostasis. Endocrinology. 2004 Apr;145(4):1640-8. Epub 2003 Dec 30. | ||||
Ref 527076 | Antidiabetic and hypolipidemic potential of DRF 2519--a dual activator of PPAR-alpha and PPAR-gamma. Eur J Pharmacol. 2004 May 3;491(2-3):195-206. | ||||
Ref 527124 | A novel oxyiminoalkanoic acid derivative, TAK-559, activates human peroxisome proliferator-activated receptor subtypes. Eur J Pharmacol. 2004 Jul 8;495(1):17-26. | ||||
Ref 527158 | J Med Chem. 2004 Aug 12;47(17):4118-27.Peroxisome proliferator-activated receptor alpha/gamma dual agonists for the treatment of type 2 diabetes. | ||||
Ref 527337 | Benzoyl 2-methyl indoles as selective PPARgamma modulators. Bioorg Med Chem Lett. 2005 Jan 17;15(2):357-62. | ||||
Ref 529182 | J Nat Prod. 2007 Dec;70(12):1934-8. Epub 2007 Nov 29.Chlorocyclinones A-D, chlorinated angucyclinones from Streptomyces sp. strongly antagonizing rosiglitazone-induced PPAR-gamma activation. | ||||
Ref 529363 | Eur J Med Chem. 2008 Dec;43(12):2699-716. Epub 2008 Feb 3.Tryptophan-containing dipeptide derivatives as potent PPARgamma antagonists: design, synthesis, biological evaluation, and molecular modeling. | ||||
Ref 530350 | J Med Chem. 2009 Aug 13;52(15):4631-9.Activation of peroxisome proliferator-activated receptor gamma (PPARgamma) by nitroalkene fatty acids: importance of nitration position and degree of unsaturation. | ||||
Ref 531262 | Bioorg Med Chem Lett. 2010 Dec 15;20(24):7331-6. Epub 2010 Oct 21.In silico identification and biochemical evaluation of novel inhibitors of NRH:quinone oxidoreductase 2 (NQO2). | ||||
Ref 531847 | Sesquiterpene lactones from Tithonia diversifolia act as peroxisome proliferator-activated receptor agonists. Bioorg Med Chem Lett. 2012 Apr 15;22(8):2954-8. | ||||
Ref 534222 | Thiazolidinediones produce a conformational change in peroxisomal proliferator-activated receptor-gamma: binding and activation correlate with antidiabetic actions in db/db mice. Endocrinology. 1996 Oct;137(10):4189-95. | ||||
Ref 534367 | Fatty acids and eicosanoids regulate gene expression through direct interactions with peroxisome proliferator-activated receptors alpha and gamma. Proc Natl Acad Sci U S A. 1997 Apr 29;94(9):4318-23. | ||||
Ref 534550 | Identification of high-affinity binding sites for the insulin sensitizer rosiglitazone (BRL-49653) in rodent and human adipocytes using a radioiodinated ligand for peroxisomal proliferator-activated receptor gamma. J Pharmacol Exp Ther. 1998 Feb;284(2):751-9. | ||||
Ref 534829 | Pharmacological profiles of a novel oral antidiabetic agent, JTT-501, an isoxazolidinedione derivative. Eur J Pharmacol. 1999 Jan 8;364(2-3):211-9. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.