Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T02752
|
||||
| Former ID |
TTDC00207
|
||||
| Target Name |
C-C chemokine receptor type 3
|
||||
| Gene Name |
CCR3
|
||||
| Synonyms |
C-C CKR-3; CC-CKR-3; CCR-3; CKR3; Chemokine receptor CCR3; Eosinophil eotaxin receptor; CCR3
|
||||
| Target Type |
Research
|
||||
| Disease | Allergic rhinitis [ICD9: 472.0, 477, 995.3; ICD10: J00, J30, J31.0, T78.4] | ||||
| Asthma [ICD10: J45] | |||||
| Function |
Receptor for a C-C type chemokine. Binds to eotaxin, eotaxin-3, MCP-3, MCP-4, RANTES and MIP-1 delta. Subsequently transduces a signal by increasing the intracellular calcium ions level. Alternative coreceptor with CD4 for HIV-1 infection.
|
||||
| BioChemical Class |
GPCR rhodopsin
|
||||
| Target Validation |
T02752
|
||||
| UniProt ID | |||||
| Sequence |
MTTSLDTVETFGTTSYYDDVGLLCEKADTRALMAQFVPPLYSLVFTVGLLGNVVVVMILI
KYRRLRIMTNIYLLNLAISDLLFLVTLPFWIHYVRGHNWVFGHGMCKLLSGFYHTGLYSE IFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIVTWGLAVLAALPEFIFYETEELFEE TLCSALYPEDTVYSWRHFHTLRMTIFCLVLPLLVMAICYTGIIKTLLRCPSKKKYKAIRL IFVIMAVFFIFWTPYNVAILLSSYQSILFGNDCERSKHLDLVMLVTEVIAYSHCCMNPVI YAFVGERFRKYLRHFFHRHLLMHLGRYIPFLPSEKLERTSSVSPSTAEPELSIVF |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | YM-344031 | Drug Info | Preclinical | Asthma | [1] |
| YM-355179 | Drug Info | Preclinical | Asthma | [1], [2] | |
| AZD-1744 | Drug Info | Discontinued in Phase 1 | Asthma | [3] | |
| DPC-168 | Drug Info | Discontinued in Phase 1 | Allergic rhinitis | [4] | |
| QAP-642 | Drug Info | Terminated | Allergic rhinitis | [5] | |
| Modulator | AZD-1744 | Drug Info | [6] | ||
| Antagonist | DPC-168 | Drug Info | [7] | ||
| QAP-642 | Drug Info | [8] | |||
| YM-344031 | Drug Info | [1] | |||
| YM-355179 | Drug Info | [1] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Cytokine-cytokine receptor interaction | ||||
| Chemokine signaling pathway | |||||
| Viral carcinogenesis | |||||
| NetPath Pathway | IL3 Signaling Pathway | ||||
| PANTHER Pathway | Inflammation mediated by chemokine and cytokine signaling pathway | ||||
| Reactome | Chemokine receptors bind chemokines | ||||
| G alpha (i) signalling events | |||||
| WikiPathways | GPCRs, Class A Rhodopsin-like | ||||
| IL1 and megakaryotyces in obesity | |||||
| IL-3 Signaling Pathway | |||||
| Peptide GPCRs | |||||
| GPCR ligand binding | |||||
| GPCR downstream signaling | |||||
| References | |||||
| REF 1 | Emerging drugs for asthma. Expert Opin Emerg Drugs. 2008 Dec;13(4):643-53. | ||||
| REF 2 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 793). | ||||
| REF 3 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025772) | ||||
| REF 4 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800015460) | ||||
| REF 5 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800023202) | ||||
| REF 6 | Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41. | ||||
| REF 7 | CC chemokine receptor-3 (CCR3) antagonists: improving the selectivity of DPC168 by reducing central ring lipophilicity. Bioorg Med Chem Lett. 2007 Jun 1;17(11):2992-7. Epub 2007 Mar 24. | ||||
| REF 8 | New Drugs and Targets for Asthma and COPD. T.T. Hansel, P.J. Barnes. 2010. Page 158. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.