Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T02532
|
||||
| Former ID |
TTDS00368
|
||||
| Target Name |
T-cell surface antigen CD2
|
||||
| Gene Name |
CD2
|
||||
| Synonyms |
Erythrocyte receptor; LFA-2; LFA-3 receptor; Rosette receptor; T-cell surface antigen T11/Leu-5; CD2
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Cancer; Psoriasis [ICD9: 140-229, 696; ICD10: L40] | ||||
| Lymphoma [ICD9: 202.8, 208.9; ICD10: C81-C86] | |||||
| Function |
CD2 interacts with lymphocyte function-associated antigen (LFA-3) and CD48/BCM1 to mediate adhesion between T-cells and other cell types. CD2 is implicated in the triggering of T- cells, the cytoplasmic domain is implicated in the signaling function.
|
||||
| BioChemical Class |
Transmembrane protein
|
||||
| UniProt ID | |||||
| Sequence |
MSFPCKFVASFLLIFNVSSKGAVSKEITNALETWGALGQDINLDIPSFQMSDDIDDIKWE
KTSDKKKIAQFRKEKETFKEKDTYKLFKNGTLKIKHLKTDDQDIYKVSIYDTKGKNVLEK IFDLKIQERVSKPKISWTCINTTLTCEVMNGTDPELNLYQDGKHLKLSQRVITHKWTTSL SAKFKCTAGNKVSKESSVEPVSCPEKGLDIYLIIGICGGGSLLMVFVALLVFYITKRKKQ RSRRNDEELETRAHRVATEERGRKPHQIPASTPQNPATSQHPPPPPGHRSQAPSHRPPPP GHRVQHQPQKRPPAPSGTQVHQQKGPPLPRPRVQPKPPHGAAENSLSPSSN |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Siplizumab | Drug Info | Phase 2 | Lymphoma | [1] |
| Siplizumab | Drug Info | Discontinued in Phase 2 | Cancer; Psoriasis | [2] | |
| Inhibitor | Alpha-D-Mannose | Drug Info | [3] | ||
| Cyclo(1,10)EIYDPGDDIK | Drug Info | [4] | |||
| Cyclo(1,10)H-EIYDPGDDIK-OH | Drug Info | [4] | |||
| Cyclo(1,11)H-ESIYDPGDDIK-OH | Drug Info | [4] | |||
| Cyclo(1,12)PenIYDTKGKNVLC-OH | Drug Info | [5] | |||
| Pen(Acm)AQFRKEKETFC(Acm)-OH | Drug Info | [5] | |||
| Pathways | |||||
| KEGG Pathway | Cell adhesion molecules (CAMs) | ||||
| Hematopoietic cell lineage | |||||
| NetPath Pathway | TCR Signaling Pathway | ||||
| IL2 Signaling Pathway | |||||
| Reactome | Cell surface interactions at the vascular wall | ||||
| WikiPathways | Cell surface interactions at the vascular wall | ||||
| References | |||||
| REF 1 | Safety profile of intravenous and subcutaneous siplizumab, an anti-CD2 monoclonal antibody, for the treatment of plaque psoriasis: results of two randomized, double-blind, placebo-controlled studies.Int J Dermatol. 2010 Jul;49(7):818-28. | ||||
| REF 2 | Emerging drugs for moderate-to-severe psoriasis. Expert Opin Emerg Drugs. 2005 Feb;10(1):35-52. | ||||
| REF 3 | How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | ||||
| REF 4 | J Med Chem. 2009 Feb 12;52(3):726-36.Design of beta-hairpin peptides for modulation of cell adhesion by beta-turn constraint. | ||||
| REF 5 | J Med Chem. 2005 Oct 6;48(20):6236-49.Structure-activity studies of peptides from the "hot-spot" region of human CD2 protein: development of peptides for immunomodulation. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.