Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T77796
|
||||
Former ID |
TTDR01197
|
||||
Target Name |
Thyrotropin-releasing hormone receptor
|
||||
Gene Name |
TRHR
|
||||
Synonyms |
TRH-R; Thyroliberin receptor; TRHR
|
||||
Target Type |
Successful
|
||||
Disease | CNS stimulant [ICD code not available] | ||||
Cognitive disorders [ICD9: 290-294, 294.0, 780.09, 780.9, 780.93; ICD10: F01-F07, F04, F05, R41.3] | |||||
Endocrine disease [ICD10: E00-E35] | |||||
Neurodegenerative disease [ICD9: 330-337; ICD10: G30-G32] | |||||
Pain [ICD9: 338, 356.0, 356.8,780; ICD10: G64, G90.0, R52, G89] | |||||
Unspecified [ICD code not available] | |||||
Function |
Receptor for thyrotropin-releasing hormone. This receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system.
|
||||
BioChemical Class |
GPCR rhodopsin
|
||||
Target Validation |
T77796
|
||||
UniProt ID | |||||
Sequence |
MENETVSELNQTQLQPRAVVALEYQVVTILLVLIICGLGIVGNIMVVLVVMRTKHMRTPT
NCYLVSLAVADLMVLVAAGLPNITDSIYGSWVYGYVGCLCITYLQYLGINASSCSITAFT IERYIAICHPIKAQFLCTFSRAKKIIIFVWAFTSLYCMLWFFLLDLNISTYKDAIVISCG YKISRNYYSPIYLMDFGVFYVVPMILATVLYGFIARILFLNPIPSDPKENSKTWKNDSTH QNTNLNVNTSNRCFNSTVSSRKQVTKMLAVVVILFALLWMPYRTLVVVNSFLSSPFQENW FLLFCRICIYLNSAINPVIYNLMSQKFRAAFRKLCNCKQKPTEKPANYSVALNYSVIKES DHFSTELDDITVTDTYLSATKVSFDDTCLASEVSFSQS |
||||
Drugs and Mode of Action | |||||
Drug(s) | protirelin | Drug Info | Approved | Unspecified | [1559458] |
Protirelin | Drug Info | Approved | CNS stimulant | [551871] | |
AZETIRELIN | Drug Info | Phase 3 | Pain | [544285] | |
MONTIRELIN TETRAHYDRATE | Drug Info | Discontinued in Preregistration | Pain | [544994] | |
Posatirelin | Drug Info | Discontinued in Phase 3 | Neurodegenerative disease | [545969] | |
JTP-2942 | Drug Info | Discontinued in Phase 2 | Cognitive disorders | [545198] | |
Modulator | AZETIRELIN | Drug Info | [531635], [533643] | ||
JTP-2942 | Drug Info | [533738] | |||
MK-771 | Drug Info | ||||
MONTIRELIN TETRAHYDRATE | Drug Info | [531635], [534144] | |||
Posatirelin | Drug Info | [526454] | |||
protirelin | Drug Info | ||||
Protirelin | Drug Info | [556264] | |||
Inhibitor | C4X-101 | Drug Info | [543794] | ||
CORYMBONE B | Drug Info | [529425] | |||
Agonist | MeTRH | Drug Info | [533507] | ||
[3H]MeTRH | Drug Info | [533535] | |||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Calcium signaling pathway | ||||
Neuroactive ligand-receptor interaction | |||||
PANTHER Pathway | Thyrotropin-releasing hormone receptor signaling pathway | ||||
Reactome | Peptide ligand-binding receptors | ||||
G alpha (q) signalling events | |||||
WikiPathways | GPCRs, Class A Rhodopsin-like | ||||
Gastrin-CREB signalling pathway via PKC and MAPK | |||||
Peptide GPCRs | |||||
GPCR ligand binding | |||||
GPCR downstream signaling | |||||
References | |||||
Ref 544285 | Developing a metagenomic view of xenobiotic metabolism. Pharmacol Res. 2013 March; 69(1): 21-31. | ||||
Ref 544994 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001824) | ||||
Ref 545198 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002435) | ||||
Ref 545969 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005568) | ||||
Ref 526454 | TRH analogs at Gedeon Richter Ltd.: highlights of experimental and clinical efficacy of posatirelin. Acta Pharm Hung. 2002;72(1):62-8. | ||||
Ref 529425 | J Nat Prod. 2008 May;71(5):881-3. Epub 2008 Apr 16.Corymbones A and B, phloroglucinols with thyrotropin releasing hormone receptor 2 binding affinity from the flowers of Corymbia peltata. | ||||
Ref 531635 | Therapeutic target database update 2012: a resource for facilitating target-oriented drug discovery. Nucleic Acids Res. 2012 Jan;40(Database issue):D1128-36. | ||||
Ref 533507 | Synthetic TRF (thyrotropin releasing factor) analogues. II. pGlu-N3imMe-His-Pro-NH2: a synthetic analogue with specific activity greater than that of TRF2. Endocrinology. 1971 Dec;89(6):1485-8. | ||||
Ref 533535 | Preparation of 3H-[3-M3-His2]TRH as an improved ligand for TRH receptors. Neuroendocrinology. 1981 May;32(5):310-6. | ||||
Ref 533643 | Intestinal absorption of azetirelin, a new thyrotropin-releasing hormone (TRH) analogue. II. In situ and in vitro absorption characteristics of azetirelin from the rat intestine. Biol Pharm Bull. 1995 Jul;18(7):976-9. | ||||
Ref 533738 | Effect of JTP-2942, a novel thyrotropin-releasing hormone analogue, on pentobarbital-induced anesthesia in rats. Eur J Pharmacol. 1995 Mar 24;276(1-2):177-82. | ||||
Ref 534144 | Montirelin hydrate (NS-3), a TRH analog, improved the disturbance of consciousness caused by head concussion and pentobarbital in mice. Nihon Yakurigaku Zasshi. 1996 May;107(5):237-45. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.