Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T93661
(Former ID: TTDR01343)
|
|||||
| Target Name |
Smad7 messenger RNA (Smad7 mRNA)
|
|||||
| Synonyms |
hSMAD7 (mRNA); Smad7 (mRNA); SMAD family member 7 (mRNA); SMAD 7 (mRNA); Mothers against decapentaplegic homolog 8 (mRNA); Mothers against decapentaplegic homolog 7 (mRNA); Mothers against DPP homolog 8 (mRNA); Mothers against DPP homolog 7 (mRNA); MADH8 (mRNA); MADH7 (mRNA); MAD homolog 8 (mRNA); MAD homolog 7 (mRNA)
Click to Show/Hide
|
|||||
| Gene Name |
SMAD7
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Crohn disease [ICD-11: DD70] | |||||
| Function |
Functions as an adapter to recruit SMURF2 to the TGF-beta receptor complex. Also acts by recruiting the PPP1R15A-PP1 complex to TGFBR1, which promotes its dephosphorylation. Positively regulates PDPK1 kinase activity by stimulating its dissociation from the 14-3-3 protein YWHAQ which acts as a negative regulator. Antagonist of signaling by TGF-beta (transforming growth factor) type 1 receptor superfamily members; has been shown to inhibit TGF-beta (Transforming growth factor) and activin signaling by associating with their receptors thus preventing SMAD2 access.
Click to Show/Hide
|
|||||
| BioChemical Class |
mRNA target
|
|||||
| UniProt ID | ||||||
| Sequence |
MFRTKRSALVRRLWRSRAPGGEDEEEGAGGGGGGGELRGEGATDSRAHGAGGGGPGRAGC
CLGKAVRGAKGHHHPHPPAAGAGAAGGAEADLKALTHSVLKKLKERQLELLLQAVESRGG TRTACLLLPGRLDCRLGPGAPAGAQPAQPPSSYSLPLLLCKVFRWPDLRHSSEVKRLCCC ESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTNY LAPGGLSDSQLLLEPGDRSHWCVVAYWEEKTRVGRLYCVQEPSLDIFYDLPQGNGFCLGQ LNSDNKSQLVQKVRSKIGCGIQLTREVDGVWVYNRSSYPIFIKSATLDNPDSRTLLVHKV FPGFSIKAFDYEKAYSLQRPNDHEFMQQPWTGFTVQISFVKGWGQCYTRQFISSCPCWLE VIFNSR Click to Show/Hide
|
|||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 1 Clinical Trial Drugs | + | ||||
| 1 | GED-0301 | Drug Info | Phase 3 | Crohn disease | [2] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| Inhibitor | [+] 1 Inhibitor drugs | + | ||||
| 1 | GED-0301 | Drug Info | [1], [3] | |||
| Cell-based Target Expression Variations | Top | |||||
|---|---|---|---|---|---|---|
| Cell-based Target Expression Variations | ||||||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| KEGG Pathway | [+] 3 KEGG Pathways | + | ||||
| 1 | Endocytosis | |||||
| 2 | TGF-beta signaling pathway | |||||
| 3 | Hippo signaling pathway | |||||
| NetPath Pathway | [+] 1 NetPath Pathways | + | ||||
| 1 | TGF_beta_Receptor Signaling Pathway | |||||
| Panther Pathway | [+] 1 Panther Pathways | + | ||||
| 1 | TGF-beta signaling pathway | |||||
| PID Pathway | [+] 6 PID Pathways | + | ||||
| 1 | Regulation of nuclear SMAD2/3 signaling | |||||
| 2 | Signaling events mediated by HDAC Class I | |||||
| 3 | IFN-gamma pathway | |||||
| 4 | BMP receptor signaling | |||||
| 5 | ALK1 signaling events | |||||
| 6 | TGF-beta receptor signaling | |||||
| Reactome | [+] 1 Reactome Pathways | + | ||||
| 1 | SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription | |||||
| WikiPathways | [+] 7 WikiPathways | + | ||||
| 1 | TGF Beta Signaling Pathway | |||||
| 2 | TGF beta Signaling Pathway | |||||
| 3 | Apoptosis-related network due to altered Notch3 in ovarian cancer | |||||
| 4 | Signaling by BMP | |||||
| 5 | Transcriptional activity of SMAD2/SMAD3:SMAD4 heterotrimer | |||||
| 6 | Signaling by TGF-beta Receptor Complex | |||||
| 7 | Integrated Breast Cancer Pathway | |||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | A phase 1 open-label trial shows that smad7 antisense oligonucleotide (GED0301) does not increase the risk of small bowel strictures in Crohn's disease. Aliment Pharmacol Ther. 2012 Nov;36(9):850-7. | |||||
| REF 2 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 3 | Phase I clinical trial of Smad7 knockdown using antisense oligonucleotide in patients with active Crohn's disease. Mol Ther. 2012 Apr;20(4):870-6. | |||||
| REF 4 | US patent application no. 6,159,697, Antisense modulation of Smad7 expression. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.