Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T93122
(Former ID: TTDNC00645)
|
|||||
Target Name |
Brain-derived neurotrophic factor (BDNF)
|
|||||
Synonyms |
Brainderived neurotrophic factor; Abrineurin
|
|||||
Gene Name |
BDNF
|
|||||
Target Type |
Clinical trial target
|
[1] | ||||
Disease | [+] 1 Target-related Diseases | + | ||||
1 | Dissociative neurological symptom disorder [ICD-11: 6B60] | |||||
Function |
Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability. During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems.
Click to Show/Hide
|
|||||
BioChemical Class |
Growth factor
|
|||||
UniProt ID | ||||||
Sequence |
MTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLA
DTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAA NMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQY FYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCT LTIKRGR Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
ADReCS ID | BADD_A05962 | |||||
HIT2.0 ID | T12T4H |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 1 Clinical Trial Drugs | + | ||||
1 | PYM-50028 | Drug Info | Phase 2 | Neurological disorder | [1] | |
Mode of Action | [+] 1 Modes of Action | + | ||||
Agonist | [+] 1 Agonist drugs | + | ||||
1 | PYM-50028 | Drug Info | [1] |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-regulating microRNAs |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 6 KEGG Pathways | + | ||||
1 | MAPK signaling pathway | |||||
2 | cAMP signaling pathway | |||||
3 | Neurotrophin signaling pathway | |||||
4 | Huntington's disease | |||||
5 | Cocaine addiction | |||||
6 | Alcoholism | |||||
NetPath Pathway | [+] 1 NetPath Pathways | + | ||||
1 | FSH Signaling Pathway | |||||
Panther Pathway | [+] 2 Panther Pathways | + | ||||
1 | Huntington disease | |||||
2 | Metabotropic glutamate receptor group II pathway | |||||
PID Pathway | [+] 4 PID Pathways | + | ||||
1 | SHP2 signaling | |||||
2 | Posttranslational regulation of adherens junction stability and dissassembly | |||||
3 | p75(NTR)-mediated signaling | |||||
4 | Neurotrophic factor-mediated Trk receptor signaling | |||||
WikiPathways | [+] 7 WikiPathways | + | ||||
1 | SIDS Susceptibility Pathways | |||||
2 | MAPK Signaling Pathway | |||||
3 | Spinal Cord Injury | |||||
4 | BDNF signaling pathway | |||||
5 | Integrated Pancreatic Cancer Pathway | |||||
6 | FSH signaling pathway | |||||
7 | miR-targeted genes in lymphocytes - TarBase |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | PYM50028, a novel, orally active, nonpeptide neurotrophic factor inducer, prevents and reverses neuronal damage induced by MPP+ in mesencephalic neurons and by MPTP in a mouse model of Parkinson's disease. FASEB J. 2008 Jul;22(7):2488-97. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.