Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T89826
|
|||||
Target Name |
SARS-CoV 3C-like protease (3CLpro)
|
|||||
Synonyms |
SARS-CoV 3C-like protease; SARS-CoV 3CLp; SARS-CoV 3CL-PRO; SARS-CoV 3CLpro
Click to Show/Hide
|
|||||
Gene Name |
SARS-CoV rep; SARS-CoV 1a-1b
|
|||||
Disease | [+] 1 Target-related Diseases | + | ||||
1 | Human immunodeficiency virus disease [ICD-11: 1C60-1C62] | |||||
Function |
Cleaves the C-terminus of replicase polyprotein at 11 sites. Recognizes substrates containing the core sequence [ILMVF]-Q-|-[SGACN]. Also able to bind an ADP-ribose-1''-phosphate (ADRP). May cleave host ATP6V1G1 thereby modifying host vacuoles intracellular pH.
Click to Show/Hide
|
|||||
BioChemical Class |
Coronaviruses polyprotein 1ab family
|
|||||
UniProt ID | ||||||
EC Number |
EC 3.4.22.-
|
|||||
Sequence |
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR
KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC SGVTFQ Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | PDB |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Preclinical Drugs | [+] 9 | + | ||||
1 | Lopinavir | Drug Info | Approved | Human immunodeficiency virus infection | [2] | |
2 | GC376 | Drug Info | Preclinical | Severe acute respiratory syndrome (SARS) | [3] | |
3 | GRL-001 | Drug Info | Preclinical | Severe acute respiratory syndrome (SARS) | [4] | |
4 | Phenylisoserine derivatives SK80 | Drug Info | Preclinical | Severe acute respiratory syndrome (SARS) | [5] | |
5 | PMID26868298-compound-N3 | Drug Info | Preclinical | Severe acute respiratory syndrome (SARS) | [4] | |
6 | PMID27240464-compound-3f | Drug Info | Preclinical | Severe acute respiratory syndrome (SARS) | [6] | |
7 | PMID28216367-compound-6d | Drug Info | Preclinical | Severe acute respiratory syndrome (SARS) | [7] | |
8 | PMID28624700-compound-3-31 | Drug Info | Preclinical | Severe acute respiratory syndrome (SARS) | [1] | |
9 | PMID30784880-compound-6-5 | Drug Info | Preclinical | Severe acute respiratory syndrome (SARS) | [8] | |
Mode of Action | [+] 1 Modes of Action | + | ||||
Inhibitor | [+] 9 Inhibitor drugs | + | ||||
1 | GC376 | Drug Info | [3] | |||
2 | GRL-001 | Drug Info | [4] | |||
3 | Lopinavir | Drug Info | [4] | |||
4 | Phenylisoserine derivatives SK80 | Drug Info | [5] | |||
5 | PMID26868298-compound-N3 | Drug Info | [4] | |||
6 | PMID27240464-compound-3f | Drug Info | [6] | |||
7 | PMID28216367-compound-6d | Drug Info | [7] | |||
8 | PMID28624700-compound-3-31 | Drug Info | [1] | |||
9 | PMID30784880-compound-6-5 | Drug Info | [8] |
Chemical Structure based Activity Landscape of Target | Top |
---|---|
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Discovery of Unsymmetrical Aromatic Disulfides as Novel Inhibitors of SARS-CoV Main Protease: Chemical Synthesis, Biological Evaluation, Molecular Docking and 3D-QSAR Study Eur J Med Chem. 2017 Sep 8;137:450-461. | |||||
REF 2 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
REF 3 | Reversal of the Progression of Fatal Coronavirus Infection in Cats by a Broad-Spectrum Coronavirus Protease Inhibitor. PLoS Pathog. 2016 Mar 30;12(3):e1005531. | |||||
REF 4 | Coronaviruses - drug discovery and therapeutic options. Nat Rev Drug Discov. 2016 May;15(5):327-47. | |||||
REF 5 | Synthesis and Evaluation of Phenylisoserine Derivatives for the SARS-CoV 3CL Protease Inhibitor. Bioorg Med Chem Lett. 2017 Jun 15;27(12):2746-2751. | |||||
REF 6 | Identification, synthesis and evaluation of SARS-CoV and MERS-CoV 3C-like protease inhibitors. Bioorg Med Chem. 2016 Jul 1;24(13):3035-3042. | |||||
REF 7 | Identification and evaluation of potent Middle East respiratory syndrome coronavirus (MERS-CoV) 3CLPro inhibitors. Antiviral Res. 2017 May;141:101-106. | |||||
REF 8 | Chemical synthesis, crystal structure, versatile evaluation of their biological activities and molecular simulations of novel pyrithiobac derivatives. Eur J Med Chem. 2019 Apr 1;167:472-484. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.