Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T77400
(Former ID: TTDR00256)
|
|||||
Target Name |
Phosphodiesterase 2A (PDE2A)
|
|||||
Synonyms |
cGMP-dependent 3',5'-cyclic phosphodiesterase; PDE-II; Cyclic-GMP phosphodiesterase; Cyclic GMP-stimulated phosphodiesterase; Cyclic GMP stimulated phosphodiesterase; CGSPDE; CGS-PDE
|
|||||
Gene Name |
PDE2A
|
|||||
Target Type |
Clinical trial target
|
[1] | ||||
Disease | [+] 4 Target-related Diseases | + | ||||
1 | Inborn purine/pyrimidine/nucleotide metabolism error [ICD-11: 5C55] | |||||
2 | Indeterminate colitis [ICD-11: DD72] | |||||
3 | Irritable bowel syndrome [ICD-11: DD91] | |||||
4 | Mood disorder [ICD-11: 6A60-6E23] | |||||
Function |
Plays an important role in growth and invasion of malignant melanoma cells (e. g. pseudomyxoma peritonei (PMP) cell line). Cyclic nucleotide phosphodiesterase with a dual-specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes.
Click to Show/Hide
|
|||||
BioChemical Class |
Phosphoric diester hydrolase
|
|||||
UniProt ID | ||||||
EC Number |
EC 3.1.4.17
|
|||||
Sequence |
MGQACGHSILCRSQQYPAARPAEPRGQQVFLKPDEPPPPPQPCADSLQDALLSLGSVIDI
SGLQRAVKEALSAVLPRVETVYTYLLDGESQLVCEDPPHELPQEGKVREAIISQKRLGCN GLGFSDLPGKPLARLVAPLAPDTQVLVMPLADKEAGAVAAVILVHCGQLSDNEEWSLQAV EKHTLVALRRVQVLQQRGPREAPRAVQNPPEGTAEDQKGGAAYTDRDRKILQLCGELYDL DASSLQLKVLQYLQQETRASRCCLLLVSEDNLQLSCKVIGDKVLGEEVSFPLTGCLGQVV EDKKSIQLKDLTSEDVQQLQSMLGCELQAMLCVPVISRATDQVVALACAFNKLEGDLFTD EDEHVIQHCFHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITE ARNLSNAEICSVFLLDQNELVAKVFDGGVVDDESYEIRIPADQGIAGHVATTGQILNIPD AYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAF SIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNF ASFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMH AFSVSHFCYLLYKNLELTNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYS SEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDL QKMAEVGYDRNNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAM GNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSH KFTIRGLPSNNSLDFLDEEYEVPDLDGTRAPINGCCSLDAE Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
HIT2.0 ID | T99TRQ |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 3 Clinical Trial Drugs | + | ||||
1 | CP-461 | Drug Info | Phase 2 | Inflammatory bowel disease | [2] | |
2 | Tofisopam | Drug Info | Phase 2 | Irritable bowel syndrome | [3] | |
3 | ND7001 | Drug Info | Phase 1 | Mood disorder | [4] | |
Mode of Action | [+] 2 Modes of Action | + | ||||
Inhibitor | [+] 65 Inhibitor drugs | + | ||||
1 | CP-461 | Drug Info | [1] | |||
2 | Tofisopam | Drug Info | [5] | |||
3 | 1,2,4-triazole [1,5-a]pyrimidin-7-yl derivative 1 | Drug Info | [6] | |||
4 | 1,2,4-triazole [1,5-a]pyrimidin-7-yl derivative 2 | Drug Info | [6] | |||
5 | 1,2,4-triazole [1,5-a]pyrimidin-7-yl derivative 3 | Drug Info | [6] | |||
6 | 1,2,4-triazole [4,3-a]quinoxaline derivative 1 | Drug Info | [6] | |||
7 | 1,2,4-triazole [4,3-a]quinoxaline derivative 2 | Drug Info | [6] | |||
8 | 1,2,4-triazole [4,3-a]quinoxaline derivative 3 | Drug Info | [6] | |||
9 | 1-aryl-4-methyl-[1,2,4]triazolo[4,3-a]quinoxaline derivative 1 | Drug Info | [6] | |||
10 | 1-aryl-4-methyl-[1,2,4]triazolo[4,3-a]quinoxaline derivative 2 | Drug Info | [6] | |||
11 | 1-aryl-4-methyl-[1,2,4]triazolo[4,3-a]quinoxaline derivative 3 | Drug Info | [6] | |||
12 | 1-aryl-4-methyl-[1,2,4]triazolo[4,3-a]quinoxaline derivative 4 | Drug Info | [6] | |||
13 | 1-aryl-4-methyl-[1,2,4]triazolo[4,3-a]quinoxaline derivative 5 | Drug Info | [6] | |||
14 | 1-aryl-4-methyl-[1,2,4]triazolo[4,3-a]quinoxaline derivative 6 | Drug Info | [6] | |||
15 | Benzodiazepine derivative 2 | Drug Info | [6] | |||
16 | Imidazo triazine derivative 1 | Drug Info | [6] | |||
17 | Imidazo triazine derivative 2 | Drug Info | [6] | |||
18 | Imidazo triazine derivative 3 | Drug Info | [6] | |||
19 | Imidazo triazine derivative 4 | Drug Info | [6] | |||
20 | Imidazo triazine derivative 5 | Drug Info | [6] | |||
21 | Imidazotriazinone derivative 1 | Drug Info | [6] | |||
22 | Imidazo[5,1-c]pyrido[2,3-e][1,2,4]triazine derivative 1 | Drug Info | [6] | |||
23 | Imidazo[5,1-c]pyrido[2,3-e][1,2,4]triazine derivative 2 | Drug Info | [6] | |||
24 | Imidazo[5,1-c]pyrido[2,3-e][1,2,4]triazine derivative 3 | Drug Info | [6] | |||
25 | Imidazo[5,1-c]pyrido[2,3-e][1,2,4]triazine derivative 4 | Drug Info | [6] | |||
26 | Imidazo[5,1-c]pyrido[2,3-e][1,2,4]triazine derivative 5 | Drug Info | [6] | |||
27 | Imidazo[5,1-c]pyrido[2,3-e][1,2,4]triazine derivative 6 | Drug Info | [6] | |||
28 | Imidazo[5,1-c]pyrido[2,3-e][1,2,4]triazine derivative 7 | Drug Info | [6] | |||
29 | Imidazo[5,1-c]pyrido[2,3-e][1,2,4]triazine derivative 8 | Drug Info | [6] | |||
30 | Imidazo[5,1-c][1,2,4]benzotriazine derivative 1 | Drug Info | [6] | |||
31 | Imidazo[5,1-c][1,2,4]benzotriazine derivative 2 | Drug Info | [6] | |||
32 | Imidazo[5,1-c][1,2,4]benzotriazine derivative 3 | Drug Info | [6] | |||
33 | Imidazo[5,1-c][1,2,4]benzotriazine derivative 4 | Drug Info | [6] | |||
34 | Oxindole derivative 1 | Drug Info | [6] | |||
35 | PMID27321640-Compound-58 | Drug Info | [6] | |||
36 | PMID27321640-Compound-59 | Drug Info | [6] | |||
37 | PMID27321640-Compound-74 | Drug Info | [6] | |||
38 | PMID27321640-Compound-75 | Drug Info | [6] | |||
39 | PMID27321640-Compound-76 | Drug Info | [6] | |||
40 | Purin-6-one derivative 1 | Drug Info | [6] | |||
41 | Pyrazolo[3,4-d]pyrimidine derivative 1 | Drug Info | [6] | |||
42 | Pyrazolo[3,4-d]pyrimidine derivative 2 | Drug Info | [6] | |||
43 | Pyrazolo[3,4-d]pyrimidine derivative 3 | Drug Info | [6] | |||
44 | Pyrazolo[3,4-d]pyrimidine derivative 4 | Drug Info | [6] | |||
45 | Pyrido[1,2,4]triazolo[4,3-a]pyrazine derivative 1 | Drug Info | [6] | |||
46 | Pyrido[1,2,4]triazolo[4,3-a]pyrazine derivative 2 | Drug Info | [6] | |||
47 | Pyrido[1,2,4]triazolo[4,3-a]pyrazine derivative 3 | Drug Info | [6] | |||
48 | Pyrido[2,3-d]pyrimidine-2,4-diamine derivative 1 | Drug Info | [6] | |||
49 | Pyrido[3,2-e][1,2,4]triazolo[4,3-a]pyrazine derivative 1 | Drug Info | [6] | |||
50 | Pyrido[3,2-e][1,2,4]triazolo[4,3-a]pyrazine derivative 2 | Drug Info | [6] | |||
51 | Triazolo-phthalazine derivative 1 | Drug Info | [6] | |||
52 | Triazolo-pyridine derivative 2 | Drug Info | [6] | |||
53 | Triazolo-pyridine derivative 3 | Drug Info | [6] | |||
54 | Triazolo-pyridine derivative 4 | Drug Info | [6] | |||
55 | Triazolo-pyridine derivative 5 | Drug Info | [6] | |||
56 | Triazolo-pyridine derivative 6 | Drug Info | [6] | |||
57 | IMAZODAN | Drug Info | [7] | |||
58 | (2R,3S)-3-(6-Amino-purin-9-yl)-nonan-2-ol | Drug Info | [8] | |||
59 | 2-Morpholin-4-yl-8-phenylethynyl-chromen-4-one | Drug Info | [9] | |||
60 | BAY-60-7550 | Drug Info | [8] | |||
61 | Benzyl-(2-pyridin-3-yl-quinazolin-4-yl)-amine | Drug Info | [10] | |||
62 | Benzyl-(2-pyridin-4-yl-quinazolin-4-yl)-amine | Drug Info | [10] | |||
63 | Cyclic Guanosine Monophosphate | Drug Info | [11] | |||
64 | EHNA | Drug Info | [12] | |||
65 | isobutylmethylxanthine | Drug Info | [13], [14] | |||
Modulator | [+] 1 Modulator drugs | + | ||||
1 | ND7001 | Drug Info | [4] |
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 3 KEGG Pathways | + | ||||
1 | Purine metabolism | |||||
2 | cGMP-PKG signaling pathway | |||||
3 | Morphine addiction | |||||
NetPath Pathway | [+] 1 NetPath Pathways | + | ||||
1 | TSH Signaling Pathway | |||||
Reactome | [+] 2 Reactome Pathways | + | ||||
1 | cGMP effects | |||||
2 | G alpha (s) signalling events |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Sulindac and its derivatives: a novel class of anticancer agents. Curr Opin Investig Drugs. 2001 May;2(5):677-83. | |||||
REF 2 | ClinicalTrials.gov (NCT00060710) CP-461 in the Treatment of Patients With Advanced Melanoma. U.S. National Institutes of Health. | |||||
REF 3 | ClinicalTrials.gov (NCT00486876) A Study of 3 Doses of Dextofisopam in Females With Irritable Bowel Syndrome. U.S. National Institutes of Health. | |||||
REF 4 | Phosphodiesterase 2 inhibitors promote axonal outgrowth in organotypic slice co-cultures. Neurosignals. 2013;21(3-4):197-212. | |||||
REF 5 | The atypical anxiolytic drug, tofisopam, selectively blocks phosphodiesterase isoenzymes and is active in the mouse model of negative symptoms of psychosis. J Neural Transm (Vienna). 2010 Nov;117(11):1319-25. | |||||
REF 6 | Towards selective phosphodiesterase 2A (PDE2A) inhibitors: a patent review (2010 - present).Expert Opin Ther Pat. 2016 Aug;26(8):933-46. | |||||
REF 7 | Cardiotonic agents. 1. 4,5-Dihydro-6-[4-(1H-imidazol-1-yl)phenyl]-3 (2H)-pyridazinones: novel positive inotropic agents for the treatment of conges... J Med Chem. 1984 Sep;27(9):1099-101. | |||||
REF 8 | The next generation of phosphodiesterase inhibitors: structural clues to ligand and substrate selectivity of phosphodiesterases. J Med Chem. 2005 May 19;48(10):3449-62. | |||||
REF 9 | PDE2 inhibition by the PI3 kinase inhibitor LY294002 and analogues. Bioorg Med Chem Lett. 2004 Jun 7;14(11):2847-51. | |||||
REF 10 | Discovery of potent cyclic GMP phosphodiesterase inhibitors. 2-Pyridyl- and 2-imidazolylquinazolines possessing cyclic GMP phosphodiesterase and th... J Med Chem. 1995 Sep 1;38(18):3547-57. | |||||
REF 11 | How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | |||||
REF 12 | Rapid regulation of PDE-2 and PDE-4 cyclic AMP phosphodiesterase activity following ligation of the T cell antigen receptor on thymocytes: analysis using the selective inhibitors erythro-9-(2-hydroxy-3-nonyl)-adenine (EHNA) and rolipram. Cell Signal. 1996 Feb;8(2):97-110. | |||||
REF 13 | The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. | |||||
REF 14 | A new generation of phosphodiesterase inhibitors: multiple molecular forms of phosphodiesterase and the potential for drug selectivity. J Med Chem. 1985 May;28(5):537-45. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.