Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T76630
(Former ID: TTDS00096)
|
|||||
| Target Name |
Cambridge pathology 1 antigen (CD52)
|
|||||
| Synonyms |
Epididymal secretory protein E5; CDW52; CD52 antigen; CD52
Click to Show/Hide
|
|||||
| Gene Name |
CD52
|
|||||
| Target Type |
Successful target
|
[1] | ||||
| Disease | [+] 2 Target-related Diseases | + | ||||
| 1 | Mature B-cell leukaemia [ICD-11: 2A82] | |||||
| 2 | Multiple sclerosis [ICD-11: 8A40] | |||||
| Function |
May play a role in carrying and orienting carbohydrate, as well as having a more specific role.
Click to Show/Hide
|
|||||
| UniProt ID | ||||||
| Sequence |
MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCF
S Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Approved Drug(s) | [+] 1 Approved Drugs | + | ||||
| 1 | Alemtuzumab | Drug Info | Approved | Chronic lymphocytic leukaemia | [2], [3], [4] | |
| Clinical Trial Drug(s) | [+] 1 Clinical Trial Drugs | + | ||||
| 1 | GZ402668 | Drug Info | Phase 1 | Multiple sclerosis | [5] | |
| Cell-based Target Expression Variations | Top | |||||
|---|---|---|---|---|---|---|
| Cell-based Target Expression Variations | ||||||
| Drug Binding Sites of Target | Top | |||||
|---|---|---|---|---|---|---|
| Ligand Name: O-Phosphoethanolamine | Ligand Info | |||||
| Structure Description | Crystal structure of anti-GLD52 Fab complex with human GLD52 peptide mimetic | PDB:6OBD | ||||
| Method | X-ray diffraction | Resolution | 2.20 Å | Mutation | No | [11] |
| PDB Sequence |
DTSQTSSPS
|
|||||
|
|
||||||
| Click to View More Binding Site Information of This Target with Different Ligands | ||||||
| Different Human System Profiles of Target | Top |
|---|---|
|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
|
|
There is no similarity protein (E value < 0.005) for this target
|
| Target Profiles in Patients | Top | |||||
|---|---|---|---|---|---|---|
| Target Expression Profile (TEP) | ||||||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| NetPath Pathway | [+] 1 NetPath Pathways | + | ||||
| 1 | IL2 Signaling Pathway | |||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Identifying alemtuzumab as an anti-myeloid cell antiangiogenic therapy for the treatment of ovarian cancer. J Transl Med. 2009 Jun 19;7:49. | |||||
| REF 2 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6770). | |||||
| REF 3 | Radium 223 dichloride for prostate cancer treatment. Drug Des Devel Ther. 2017 Sep 6;11:2643-2651. | |||||
| REF 4 | New developments in immunosuppressive therapy for heart transplantation. Expert Opin Emerg Drugs. 2009 Mar;14(1):1-21. | |||||
| REF 5 | ClinicalTrials.gov (NCT02282826) A First-in-human, Single Ascending Dose Study of GZ402668 in Patients With Progressive Multiple Sclerosis. U.S. National Institutes of Health. | |||||
| REF 6 | Clinical evaluation of busulfan, cladribine and alemtuzumab as reduced intensity conditioning for stem cell transplantation. Ann Transplant. 2009 Apr-Jun;14(2):7-12. | |||||
| REF 7 | CD52 expression in peripheral T-cell lymphomas determined by combined immunophenotyping using tumor cell specific T-cell receptor antibodies. Leuk Lymphoma. 2009 Jun;50(6):1010-6. | |||||
| REF 8 | Targeted therapy for chronic lymphocytic leukemia. Target Oncol. 2009 Jan;4(1):11-21. | |||||
| REF 9 | Characterization of a Next Generation Anti-CD52 Antibody. Neurology. April 6, 2015 vol. 84 no. 14. | |||||
| REF 10 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
| REF 11 | Engineering an anti-CD52 antibody for enhanced deamidation stability. MAbs. 2019 Oct;11(7):1266-1275. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.