Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T75440
(Former ID: TTDS00454)
|
|||||
Target Name |
Translocator protein (TSPO)
|
|||||
Synonyms |
Peripheral-type benzodiazepine receptor; Peripheral benzodiazepine receptor; PKBS; PBR; Mitochondrial benzodiazepine receptor; MBR; BZRP
|
|||||
Gene Name |
TSPO
|
|||||
Target Type |
Successful target
|
[1] | ||||
Disease | [+] 6 Target-related Diseases | + | ||||
1 | Anxiety disorder [ICD-11: 6B00-6B0Z] | |||||
2 | Epilepsy/seizure [ICD-11: 8A61-8A6Z] | |||||
3 | Insomnia [ICD-11: 7A00-7A0Z] | |||||
4 | Intentional self-harm [ICD-11: PC91] | |||||
5 | Mood/affect symptom [ICD-11: MB24] | |||||
6 | Tonus and reflex abnormality [ICD-11: MB47] | |||||
Function |
Promotes the transport of cholesterol across mitochondrial membranes and may play a role in lipid metabolism, but its precise physiological role is controversial. It is apparently not required for steroid hormone biosynthesis. Was initially identified as peripheral-type benzodiazepine receptor; can also bind isoquinoline carboxamides. Can bind protoporphyrin IX and may play a role in the transport of porphyrins and heme.
Click to Show/Hide
|
|||||
BioChemical Class |
Cholesterol/porphyrin uptake translocator
|
|||||
UniProt ID | ||||||
Sequence |
MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAM
GYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAA ATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNHGWRGGRRLPE Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
ADReCS ID | BADD_A00167 ; BADD_A00264 ; BADD_A03955 ; BADD_A05517 | |||||
HIT2.0 ID | T67U3B |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Approved Drug(s) | [+] 23 Approved Drugs | + | ||||
1 | Adinazolam | Drug Info | Approved | Anxiety disorder | [2] | |
2 | Alpidem | Drug Info | Approved | Anxiety disorder | [3] | |
3 | Alprazolam | Drug Info | Approved | Anxiety disorder | [4], [5] | |
4 | Chlordiazepoxide | Drug Info | Approved | Anxiety disorder | [6], [7] | |
5 | Chlormezanone | Drug Info | Approved | Anxiety disorder | [3], [8], [9] | |
6 | Cinolazepam | Drug Info | Approved | Muscle spasm | [10] | |
7 | Clorazepate | Drug Info | Approved | Anxiety disorder | [11], [12] | |
8 | Clotiazepam | Drug Info | Approved | Anxiety disorder | [13] | |
9 | Diazepam | Drug Info | Approved | Epilepsy | [14], [15] | |
10 | Estazolam | Drug Info | Approved | Insomnia | [16], [17] | |
11 | Eszopiclone | Drug Info | Approved | Insomnia | [18], [19] | |
12 | Fludiazepam | Drug Info | Approved | Anxiety disorder | [20] | |
13 | Flumazenil | Drug Info | Approved | Benzodiazepine overdose | [21], [22] | |
14 | Flunitrazepam | Drug Info | Approved | Insomnia | [23], [24] | |
15 | Flurazepam | Drug Info | Approved | Insomnia | [25], [26] | |
16 | Halazepam | Drug Info | Approved | Anxiety disorder | [27], [28] | |
17 | Lorazepam | Drug Info | Approved | Anxiety disorder | [29], [30] | |
18 | Midazolam | Drug Info | Approved | Irritability | [31], [32] | |
19 | Oxazepam | Drug Info | Approved | Anxiety disorder | [33], [34] | |
20 | Prazepam | Drug Info | Approved | Anxiety disorder | [35], [36] | |
21 | Quazepam | Drug Info | Approved | Insomnia | [37], [38] | |
22 | Temazepam | Drug Info | Approved | Insomnia | [39], [40] | |
23 | Triazolam | Drug Info | Approved | Insomnia | [41], [34] | |
Clinical Trial Drug(s) | [+] 7 Clinical Trial Drugs | + | ||||
1 | 11C-PBR-28 | Drug Info | Phase 2 | Brain disease | [42] | |
2 | Dextofisopam | Drug Info | Phase 2 | Irritable bowel syndrome | [43] | |
3 | ONO-2952 | Drug Info | Phase 2 | Irritable bowel syndrome | [44] | |
4 | SSR-180575 | Drug Info | Phase 2 | Rheumatoid arthritis | [45] | |
5 | TLN-4601 | Drug Info | Phase 2 | Solid tumour/cancer | [46] | |
6 | 18F-FEDAA-1106 | Drug Info | Phase 1 | Alzheimer disease | [47] | |
7 | BAY-85-8102 | Drug Info | Phase 1 | Brain disease | [48] | |
Discontinued Drug(s) | [+] 10 Discontinued Drugs | + | ||||
1 | Ro-16-6028 | Drug Info | Discontinued in Phase 3 | Anxiety disorder | [49], [50] | |
2 | Emapunil | Drug Info | Discontinued in Phase 2 | Anxiety disorder | [51], [52] | |
3 | Lirequinil | Drug Info | Discontinued in Phase 2 | Anxiety disorder | [53] | |
4 | S-8510 | Drug Info | Discontinued in Phase 2 | Cognitive impairment | [54] | |
5 | TRO-40303 | Drug Info | Discontinued in Phase 2 | Lateral sclerosis | [55] | |
6 | Imepitoin | Drug Info | Discontinued in Phase 1 | Convulsion | [56] | |
7 | DAA-1097 | Drug Info | Terminated | Anxiety disorder | [57] | |
8 | Miltirone | Drug Info | Terminated | Anxiety disorder | [58] | |
9 | NNC-13-8119 | Drug Info | Terminated | Anxiety disorder | [59] | |
10 | NS-2979 | Drug Info | Terminated | Pain | [60] | |
Mode of Action | [+] 7 Modes of Action | + | ||||
Agonist | [+] 18 Agonist drugs | + | ||||
1 | Adinazolam | Drug Info | [61] | |||
2 | Alprazolam | Drug Info | [1], [63] | |||
3 | Chlormezanone | Drug Info | [65] | |||
4 | Clotiazepam | Drug Info | [67] | |||
5 | Diazepam | Drug Info | [68], [69] | |||
6 | Estazolam | Drug Info | [70], [71] | |||
7 | Eszopiclone | Drug Info | [63], [72] | |||
8 | Fludiazepam | Drug Info | [73] | |||
9 | Flunitrazepam | Drug Info | [1] | |||
10 | Oxazepam | Drug Info | [75] | |||
11 | Dextofisopam | Drug Info | [43] | |||
12 | BAY-85-8102 | Drug Info | [74] | |||
13 | Emapunil | Drug Info | [84] | |||
14 | Lirequinil | Drug Info | [85] | |||
15 | S-8510 | Drug Info | [3] | |||
16 | Imepitoin | Drug Info | [87] | |||
17 | DAA-1097 | Drug Info | [88] | |||
18 | Benzodiazepine | Drug Info | [74] | |||
Inhibitor | [+] 12 Inhibitor drugs | + | ||||
1 | Alpidem | Drug Info | [62] | |||
2 | SSR-180575 | Drug Info | [3], [78] | |||
3 | (R)PK-11195 | Drug Info | [93] | |||
4 | 2-(2-Phenyl-1H-indol-3-yl)-N,N-dipropyl-acetamide | Drug Info | [94] | |||
5 | 4-Methoxy-5-phenyl-6-thia-10b-aza-benzo[e]azulene | Drug Info | [95] | |||
6 | 5-Phenyl-6-thia-10b-aza-benzo[e]azulen-4-one | Drug Info | [96] | |||
7 | 5-Phenyl-6-thia-10b-aza-benzo[e]azulene | Drug Info | [95] | |||
8 | 6-Thia-10b-aza-benzo[e]azulen-4-one | Drug Info | [96] | |||
9 | N,N-Diethyl-2-(2-phenyl-1H-indol-3-yl)-acetamide | Drug Info | [94] | |||
10 | N,N-Dihexyl-2-(2-phenyl-1H-indol-3-yl)-acetamide | Drug Info | [94] | |||
11 | N,N-Dimethyl-2-(2-phenyl-1H-indol-3-yl)-acetamide | Drug Info | [94] | |||
12 | N-Hexyl-2-(2-phenyl-1H-indol-3-yl)-acetamide | Drug Info | [94] | |||
Modulator | [+] 18 Modulator drugs | + | ||||
1 | Chlordiazepoxide | Drug Info | [64] | |||
2 | Clorazepate | Drug Info | [64] | |||
3 | Flurazepam | Drug Info | [64] | |||
4 | Halazepam | Drug Info | [64] | |||
5 | Lorazepam | Drug Info | [64] | |||
6 | Midazolam | Drug Info | [64] | |||
7 | Prazepam | Drug Info | [64] | |||
8 | Quazepam | Drug Info | [64] | |||
9 | Temazepam | Drug Info | [64] | |||
10 | Triazolam | Drug Info | [64] | |||
11 | TLN-4601 | Drug Info | [79] | |||
12 | 18F-FEDAA-1106 | Drug Info | [80] | |||
13 | Ro-16-6028 | Drug Info | [83] | |||
14 | TRO-40303 | Drug Info | [86] | |||
15 | Miltirone | Drug Info | [90] | |||
16 | NNC-13-8119 | Drug Info | [91] | |||
17 | NS-2979 | Drug Info | [92] | |||
18 | U-89854 | Drug Info | [74] | |||
Binder | [+] 7 Binder drugs | + | ||||
1 | Cinolazepam | Drug Info | [66] | |||
2 | 11C-PBR-28 | Drug Info | [76] | |||
3 | 11C-PBR-170 | Drug Info | [74] | |||
4 | FGIN-1-27 | Drug Info | [97] | |||
5 | PK 11195 | Drug Info | [97] | |||
6 | Ro 5-4864 | Drug Info | [97], [98] | |||
7 | TGSC01AA(4) | Drug Info | [74] | |||
Antagonist | [+] 2 Antagonist drugs | + | ||||
1 | Flumazenil | Drug Info | [74] | |||
2 | ONO-2952 | Drug Info | [77] | |||
Ligand | [+] 93 Ligand drugs | + | ||||
1 | Aryl oxyanilide derivative 1 | Drug Info | [81] | |||
2 | Aryl oxyanilide derivative 2 | Drug Info | [81] | |||
3 | Aryl oxyanilide derivative 3 | Drug Info | [81] | |||
4 | Benzimidazolone acetamide derivative 1 | Drug Info | [81] | |||
5 | Benzimidazolone acetamide derivative 2 | Drug Info | [81] | |||
6 | Benzodiazepine derivative 1 | Drug Info | [81] | |||
7 | Benzothiazepine analog 1 | Drug Info | [81] | |||
8 | Benzothiazepine analog 2 | Drug Info | [81] | |||
9 | Benzothiazepine analog 3 | Drug Info | [81] | |||
10 | Benzothiazepine analog 4 | Drug Info | [81] | |||
11 | Benzothiazepine analog 5 | Drug Info | [81] | |||
12 | Benzothiazepine analog 6 | Drug Info | [81] | |||
13 | Benzothiazepine analog 7 | Drug Info | [81] | |||
14 | Benzothiazepine analog 8 | Drug Info | [81] | |||
15 | Benzothiazepine analog 9 | Drug Info | [81] | |||
16 | Benzoxazepine analog 1 | Drug Info | [81] | |||
17 | Bidentate pyrazolopyrimidine acetamide analog 1 | Drug Info | [81] | |||
18 | Bidentate pyrazolopyrimidine acetamide analog 2 | Drug Info | [81] | |||
19 | Bidentate pyrazolopyrimidine acetamide analog 3 | Drug Info | [81] | |||
20 | Bidentate pyrazolopyrimidine acetamide analog 4 | Drug Info | [81] | |||
21 | Imidazopyridine acetamide analog 1 | Drug Info | [81] | |||
22 | Imidazopyridine acetamide analog 2 | Drug Info | [81] | |||
23 | Imidazopyridine acetamide analog 3 | Drug Info | [81] | |||
24 | Imidazopyridine acetamide analog 4 | Drug Info | [81] | |||
25 | Imidazopyridine acetamide analog 5 | Drug Info | [81] | |||
26 | Imidazopyridine acetamide analog 6 | Drug Info | [81] | |||
27 | Imidazopyridine acetamide analog 7 | Drug Info | [81] | |||
28 | Imidazopyridine derivative 1 | Drug Info | [81] | |||
29 | Imidazopyridine derivative 2 | Drug Info | [81] | |||
30 | Imidazo[1,2-b]pyridazine acetamide derivative 1 | Drug Info | [81] | |||
31 | Imidazo[1,2-b]pyridazine acetamide derivative 2 | Drug Info | [81] | |||
32 | Imidazo[1,2-b]pyridazine acetamide derivative 3 | Drug Info | [81] | |||
33 | Imidazo[1,2-b]pyridazine acetamide derivative 4 | Drug Info | [81] | |||
34 | Imidazo[1,2-b]pyridazine acetamide derivative 5 | Drug Info | [81] | |||
35 | Imidazo[1,2-b]pyridazine acetamide derivative 6 | Drug Info | [81] | |||
36 | Imidazo[1,2-b]pyridazine acetamide derivative 7 | Drug Info | [81] | |||
37 | Indole-based analog 10 | Drug Info | [82] | |||
38 | Indole-based analog 5 | Drug Info | [82] | |||
39 | Indole-based analog 9 | Drug Info | [82] | |||
40 | Iodophenyl-N-methyl-N-fluoroalkyl-3-isoquinoline carboxamide derivative 1 | Drug Info | [81] | |||
41 | Iodophenyl-N-methyl-N-fluoroalkyl-3-isoquinoline carboxamide derivative 2 | Drug Info | [81] | |||
42 | Iodophenyl-N-methyl-N-fluoroalkyl-3-isoquinoline carboxamide derivative 3 | Drug Info | [81] | |||
43 | Isoquinoline carboxamide derivative 1 | Drug Info | [81] | |||
44 | Phenylpurine acetamide analog 1 | Drug Info | [81] | |||
45 | Phenylpurine acetamide analog 2 | Drug Info | [81] | |||
46 | PMID27599163-Compound-52 | Drug Info | [82] | |||
47 | PMID27599163-Compound-75 | Drug Info | [82] | |||
48 | PMID27599163-Compound-76 | Drug Info | [82] | |||
49 | PMID27599163-Compound-77 | Drug Info | [82] | |||
50 | PMID27599163-Compound-78 | Drug Info | [82] | |||
51 | PMID27599163-Compound-79 | Drug Info | [82] | |||
52 | PMID27599163-Compound-81 | Drug Info | [82] | |||
53 | PMID27599163-Compound-82 | Drug Info | [82] | |||
54 | PMID27607364-Compound-10 | Drug Info | [81] | |||
55 | PMID27607364-Compound-141 | Drug Info | [81] | |||
56 | PMID27607364-Compound-162 | Drug Info | [81] | |||
57 | PMID27607364-Compound-4 | Drug Info | [81] | |||
58 | PMID27607364-Compound-58 | Drug Info | [81] | |||
59 | PMID27607364-Compound-59 | Drug Info | [81] | |||
60 | PMID27607364-Compound-60 | Drug Info | [81] | |||
61 | PMID27607364-Compound-61 | Drug Info | [81] | |||
62 | PMID27607364-Compound-62 | Drug Info | [81] | |||
63 | PMID27607364-Compound-63 | Drug Info | [81] | |||
64 | PMID27607364-Compound-64 | Drug Info | [81] | |||
65 | PMID27607364-Compound-65 | Drug Info | [81] | |||
66 | Pyrazolopyrimidine acetamide analog 1 | Drug Info | [81] | |||
67 | Pyrazolopyrimidine acetamide analog 2 | Drug Info | [81] | |||
68 | Quinazoline derivative 2 | Drug Info | [81] | |||
69 | Quinazoline derivative 3 | Drug Info | [81] | |||
70 | Quinazoline derivative 4 | Drug Info | [81] | |||
71 | Quinazoline derivative 5 | Drug Info | [81] | |||
72 | Quinazoline derivative 6 | Drug Info | [81] | |||
73 | Quinazoline derivative 7 | Drug Info | [81] | |||
74 | Quinoline carboxamide derivative 10 | Drug Info | [81] | |||
75 | Quinoline carboxamide derivative 4 | Drug Info | [81] | |||
76 | Quinoline carboxamide derivative 5 | Drug Info | [81] | |||
77 | Quinoline carboxamide derivative 6 | Drug Info | [81] | |||
78 | Quinoline carboxamide derivative 7 | Drug Info | [81] | |||
79 | Quinoline carboxamide derivative 8 | Drug Info | [81] | |||
80 | Quinoline carboxamide derivative 9 | Drug Info | [81] | |||
81 | Tricyclic indole compound 1 | Drug Info | [82] | |||
82 | Tricyclic indole compound 10 | Drug Info | [82] | |||
83 | Tricyclic indole compound 11 | Drug Info | [82] | |||
84 | Tricyclic indole compound 12 | Drug Info | [82] | |||
85 | Tricyclic indole compound 14 | Drug Info | [82] | |||
86 | Tricyclic indole compound 2 | Drug Info | [82] | |||
87 | Tricyclic indole compound 3 | Drug Info | [82] | |||
88 | Tricyclic indole compound 4 | Drug Info | [82] | |||
89 | Tricyclic indole compound 5 | Drug Info | [82] | |||
90 | Tricyclic indole compound 6 | Drug Info | [82] | |||
91 | Tricyclic indole compound 7 | Drug Info | [82] | |||
92 | Tricyclic indole compound 8 | Drug Info | [82] | |||
93 | Tricyclic indole compound 9 | Drug Info | [82] | |||
Suppressor | [+] 1 Suppressor drugs | + | ||||
1 | Ginkgolide B (GKB) | Drug Info | [89] |
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Co-Targets | Top | |||||
---|---|---|---|---|---|---|
Co-Targets |
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 2 KEGG Pathways | + | ||||
1 | Neuroactive ligand-receptor interaction | |||||
2 | HTLV-I infection |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation | ||||||
Target QSAR Model |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Comparison of five benzodiazepine-receptor agonists on buprenorphine-induced mu-opioid receptor regulation. J Pharmacol Sci. 2009 May;110(1):36-46. | |||||
REF 2 | Drug information of Adinazolam, 2008. eduDrugs. | |||||
REF 3 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
REF 4 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7111). | |||||
REF 5 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 074046. | |||||
REF 6 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3370). | |||||
REF 7 | Use of the accelerating rotarod for assessment of motor performance decrement induced by potential anticonvulsant compounds in nerve agent poisoning. Drug Chem Toxicol. 1992;15(3):177-201. | |||||
REF 8 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7323). | |||||
REF 9 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 011467. | |||||
REF 10 | Drug information of Cinolazepam, 2008. eduDrugs. | |||||
REF 11 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7548). | |||||
REF 12 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 071852. | |||||
REF 13 | Drug information of Clotiazepam, 2008. eduDrugs. | |||||
REF 14 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3364). | |||||
REF 15 | ClinicalTrials.gov (NCT01939093) Therapeutic Effect of Quetiapine on Methamphetamine-Induced Psychosis. U.S. National Institutes of Health. | |||||
REF 16 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7550). | |||||
REF 17 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 074818. | |||||
REF 18 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7429). | |||||
REF 19 | Emerging therapies for fibromyalgia. Expert Opin Emerg Drugs. 2008 Mar;13(1):53-62. | |||||
REF 20 | Drug information of Fludiazepam, 2008. eduDrugs. | |||||
REF 21 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4192). | |||||
REF 22 | ClinicalTrials.gov (NCT00997087) A Randomized, Double-Blind, Placebo-Controlled Trial of Flumazenil for the Treatment of Obsessive Compulsive Disorder. U.S. National Institutes of Health. | |||||
REF 23 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4360). | |||||
REF 24 | Drug information of Flunitrazepam, 2008. eduDrugs. | |||||
REF 25 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7188). | |||||
REF 26 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 070344. | |||||
REF 27 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7195). | |||||
REF 28 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 017736. | |||||
REF 29 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5884). | |||||
REF 30 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 071117. | |||||
REF 31 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3342). | |||||
REF 32 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 075154. | |||||
REF 33 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7253). | |||||
REF 34 | What every dentist should know about the "z-sedatives". J Mass Dent Soc. 2007 Fall;56(3):44-5. | |||||
REF 35 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7275). | |||||
REF 36 | Drug information of Prazepam, 2008. eduDrugs. | |||||
REF 37 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7288). | |||||
REF 38 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 018708. | |||||
REF 39 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7300). | |||||
REF 40 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 070919. | |||||
REF 41 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7313). | |||||
REF 42 | ClinicalTrials.gov (NCT02513589) Molecular Imaging of Inflammation With 18F-PBR06 to Identify Unstable Carotid Plaques in Patients With Stroke. | |||||
REF 43 | Emerging drugs for irritable bowel syndrome. Expert Opin Emerg Drugs. 2006 May;11(2):293-313. | |||||
REF 44 | ClinicalTrials.gov (NCT01887002) Study to Evaluate the Effects of ONO-2952 on Pain Perception Produced by Rectal Distention in Female Subjects With Diarrhea-Predominant Irritable Bowel Syndrome (IBS-D). U.S. National Institutes of Health. | |||||
REF 45 | ClinicalTrials.gov (NCT00502515) Dose-effect of SSR180575 in Diabetic Neuropathy. U.S. National Institutes of Health. | |||||
REF 46 | ClinicalTrials.gov (NCT00730262) Efficacy Study of TLN-4601 in Patients With Recurring Glioblastoma Multiforme. U.S. National Institutes of Health. | |||||
REF 47 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031827) | |||||
REF 48 | ClinicalTrials.gov (NCT01009359) Evaluation of the Neuroinflammation Pattern of BAY85-8102 F-18, DPA-714 in Probable Alzheimers Disease Patients Versus Healthy Volunteers and Radiation Dosimetry of F18, DPA-714 in Healthy Volunteers. U.S. National Institutes of Health. | |||||
REF 49 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4146). | |||||
REF 50 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000640) | |||||
REF 51 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8704). | |||||
REF 52 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800013611) | |||||
REF 53 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001968) | |||||
REF 54 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005238) | |||||
REF 55 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800033814) | |||||
REF 56 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008368) | |||||
REF 57 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800012540) | |||||
REF 58 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003466) | |||||
REF 59 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004060) | |||||
REF 60 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800013494) | |||||
REF 61 | Effects of antidepressants and benzodiazepine treatments on the dendritic structure of CA3 pyramidal neurons after chronic stress. Eur J Pharmacol. 1999 Apr 29;371(2-3):113-22. | |||||
REF 62 | Anxiolytic-like effects of N,N-dialkyl-2-phenylindol-3-ylglyoxylamides by modulation of translocator protein promoting neurosteroid biosynthesis. J Med Chem. 2008 Sep 25;51(18):5798-806. | |||||
REF 63 | Glutamate- and GABA-based CNS therapeutics. Curr Opin Pharmacol. 2006 Feb;6(1):7-17. | |||||
REF 64 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. | |||||
REF 65 | Successful treatment of anxiety with a single night-time dose of chlormezanone: double-blind comparison with diazepam. Curr Med Res Opin. 1982;8(1):33-8. | |||||
REF 66 | Short-term sleep laboratory studies with cinolazepam in situational insomnia induced by traffic noise. Int J Clin Pharmacol Res. 1987;7(5):407-18. | |||||
REF 67 | Effects of benzodiazepines and non-benzodiazepine compounds on the GABA-induced response in frog isolated sensory neurones. Br J Pharmacol. 1989 Nov;98(3):735-40. | |||||
REF 68 | Translocator protein (18 kDa) mediates the pro-growth effects of diazepam on Ehrlich tumor cells in vivo. Eur J Pharmacol. 2010 Jan 25;626(2-3):131-8. | |||||
REF 69 | The alpha5(H105R) mutation impairs alpha5 selective binding properties by altered positioning of the alpha5 subunit in GABAA receptors containing t... J Neurochem. 2009 Jul;110(1):244-54. | |||||
REF 70 | Design and synthesis of new 2-substituted-5-(2-benzylthiophenyl)-1,3,4-oxadiazoles as benzodiazepine receptor agonists. Bioorg Med Chem Lett. 2005 Jun 15;15(12):3126-9. | |||||
REF 71 | Design and synthesis of 4H-3-(2-phenoxy)phenyl-1,2,4-triazole derivatives as benzodiazepine receptor agonists. Bioorg Med Chem. 2003 Mar 6;11(5):769-73. | |||||
REF 72 | New hypnotics: perspectives from sleep physiology. Vertex. 2007 Jul-Aug;18(74):294-9. | |||||
REF 73 | Benzodiazepines and their metabolites: relationship between binding affinity to the benzodiazepine receptor and pharmacological activity. Life Sci. 1985 Jan 14;36(2):113-9. | |||||
REF 74 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2879). | |||||
REF 75 | Effects of the combination of metyrapone and oxazepam on cocaine and food self-administration in rats. Pharmacol Biochem Behav. 2008 Nov;91(1):181-9. | |||||
REF 76 | PET imaging with [11C]PBR28 can localize and quantify upregulated peripheral benzodiazepine receptors associated with cerebral ischemia in rat. Neurosci Lett. 2007 Jan 16;411(3):200-5. | |||||
REF 77 | Anti-stress effects of ONO-2952, a novel translocator protein 18 kDa antagonist, in rats. Neuropharmacology. 2015 Jul 17;99:51-66. | |||||
REF 78 | SSR180575 (7-chloro-N,N,5-trimethyl-4-oxo-3-phenyl-3,5-dihydro-4H-pyridazino[4,5-b]indole-1-acetamide), a peripheral benzodiazepine receptor ligand, promotes neuronal survival and repair. J PharmacolExp Ther. 2002 Jun;301(3):1067-78. | |||||
REF 79 | TLN-4601 peripheral benzodiazepine receptor (PBR/TSPO) binding properties do not mediate apoptosis but confer tumor-specific accumulation.Biochem Pharmacol.2010 Nov 15;80(10):1572-9. | |||||
REF 80 | Role of peripheral benzodiazepine receptors in mitochondrial, cellular, and cardiac damage induced by oxidative stress and ischemia-reperfusion. J Pharmacol Exp Ther. 2003 Sep;306(3):828-37. | |||||
REF 81 | Translocator protein (TSPO) ligands for the diagnosis or treatment of neurodegenerative diseases: a patent review (2010-2015; part 1).Expert Opin Ther Pat. 2016 Nov;26(11):1325-1351. | |||||
REF 82 | Translocator protein (TSPO) ligands for the diagnosis or treatment of neurodegenerative diseases: a patent review (2010 - 2015; part 2).Expert Opin Ther Pat. 2016 Nov;26(11):1353-1366. | |||||
REF 83 | Bretazenil, a benzodiazepine receptor partial agonist, as an adjunct in the prophylactic treatment of OP poisoning. J Appl Toxicol. 2001 Dec;21 Suppl 1:S115-9. | |||||
REF 84 | Novel drugs and therapeutic targets for severe mood disorders. Neuropsychopharmacology. 2008 Aug;33(9):2080-92. | |||||
REF 85 | Pharmacokinetics and pharmacodynamics of Ro 41-3696, a novel nonbenzodiazepine hypnotic. J Clin Pharmacol. 1995 Aug;35(8):821-9. | |||||
REF 86 | Translation of TRO40303 from myocardial infarction models to demonstration of safety and tolerance in a randomized Phase I trial. J Transl Med. 2014; 12: 38. | |||||
REF 87 | The pharmacology of imepitoin: the first partial benzodiazepine receptor agonist developed for the treatment of epilepsy. CNS Drugs. 2014 Jan;28(1):29-43. | |||||
REF 88 | Neuropharmacological profile of peripheral benzodiazepine receptor agonists, DAA1097 and DAA1106. Life Sci. 1999;64(16):1455-64. | |||||
REF 89 | Drug-induced inhibition of the peripheral-type benzodiazepine receptor expression and cell proliferation in human breast cancer cells. Anticancer Res. 2000 Sep-Oct;20(5A):2835-47. | |||||
REF 90 | Miltirone, a central benzodiazepine receptor partial agonist from a Chinese medicinal herb Salvia miltiorrhiza. Neurosci Lett. 1991 Jun 24;127(2):237-41. | |||||
REF 91 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004060) | |||||
REF 92 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800013494) | |||||
REF 93 | [18F]FMDAA1106 and [18F]FEDAA1106: two positron-emitter labeled ligands for peripheral benzodiazepine receptor (PBR). Bioorg Med Chem Lett. 2003 Jan 20;13(2):201-4. | |||||
REF 94 | Chemistry, binding affinities, and behavioral properties of a new class of "antineophobic" mitochondrial DBI receptor complex (mDRC) ligands. J Med Chem. 1993 Oct 1;36(20):2908-20. | |||||
REF 95 | A concerted study using binding measurements, X-ray structural data, and molecular modeling on the stereochemical features responsible for the affi... J Med Chem. 1995 Nov 10;38(23):4730-8. | |||||
REF 96 | Novel ligands specific for mitochondrial benzodiazepine receptors: 6-arylpyrrolo[2,1-d][1,5]benzothiazepine derivatives. Synthesis, structure-activ... J Med Chem. 1994 May 13;37(10):1427-38. | |||||
REF 97 | Specific ligands of the peripheral benzodiazepine receptor induce apoptosis and cell cycle arrest in human colorectal cancer cells. Br J Cancer. 2001 Nov 30;85(11):1771-80. | |||||
REF 98 | Antiproliferative and differentiating effects of benzodiazepine receptor ligands on B16 melanoma cells. Biochem Pharmacol. 1998 Oct 15;56(8):1029-34. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.