Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T72171
(Former ID: TTDI02236)
|
|||||
| Target Name |
CCR5 messenger RNA (CCR5 mRNA)
|
|||||
| Synonyms |
HIV-1 fusion coreceptor (mRNA); HIV-1 fusion co-receptor (mRNA); Chemokine receptor CCR5 (mRNA); CMKBR5 (mRNA); CHEMR13 (mRNA); CD195 antigen (mRNA); CD195 (mRNA); CCR-5 (mRNA); CC-CKR-5 (mRNA); C-C chemokine receptor type 5 (mRNA); C-C CKR-5 (mRNA)
Click to Show/Hide
|
|||||
| Gene Name |
CCR5
|
|||||
| Target Type |
Successful target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Human immunodeficiency virus disease [ICD-11: 1C60-1C62] | |||||
| Function |
May play a role in the control of granulocytic lineage proliferation or differentiation. Receptor for a number of inflammatory CC-chemokines including CCL3/MIP-1-alpha, CCL4/MIP-1-beta and RANTES and subsequently transduces a signal by increasing the intracellular calcium ion level.
Click to Show/Hide
|
|||||
| BioChemical Class |
mRNA target
|
|||||
| UniProt ID | ||||||
| Sequence |
MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKR
LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII LLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSS HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL Click to Show/Hide
|
|||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Approved Drug(s) | [+] 1 Approved Drugs | + | ||||
| 1 | Maraviroc | Drug Info | Approved | Human immunodeficiency virus infection | [2], [3], [4] | |
| Clinical Trial Drug(s) | [+] 1 Clinical Trial Drugs | + | ||||
| 1 | DdRNAi therapy rHIV7-shl-TAR-CCR5RZ, stem cells | Drug Info | Phase 1/2 | Human immunodeficiency virus infection | [5] | |
| Discontinued Drug(s) | [+] 1 Discontinued Drugs | + | ||||
| 1 | SCH-C | Drug Info | Discontinued in Phase 1 | Human immunodeficiency virus infection | [6], [7] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| Antagonist | [+] 3 Antagonist drugs | + | ||||
| 1 | Maraviroc | Drug Info | [1] | |||
| 2 | SCH-C | Drug Info | [9] | |||
| 3 | viral macrophage inflammatory protein-II | Drug Info | [10] | |||
| Cell-based Target Expression Variations | Top | |||||
|---|---|---|---|---|---|---|
| Cell-based Target Expression Variations | ||||||
| Co-Targets | Top | |||||
|---|---|---|---|---|---|---|
| Co-Targets | ||||||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| KEGG Pathway | [+] 5 KEGG Pathways | + | ||||
| 1 | Cytokine-cytokine receptor interaction | |||||
| 2 | Chemokine signaling pathway | |||||
| 3 | Endocytosis | |||||
| 4 | Toxoplasmosis | |||||
| 5 | Viral carcinogenesis | |||||
| NetPath Pathway | [+] 3 NetPath Pathways | + | ||||
| 1 | TSLP Signaling Pathway | |||||
| 2 | TCR Signaling Pathway | |||||
| 3 | IL2 Signaling Pathway | |||||
| Panther Pathway | [+] 1 Panther Pathways | + | ||||
| 1 | Inflammation mediated by chemokine and cytokine signaling pathway | |||||
| PID Pathway | [+] 1 PID Pathways | + | ||||
| 1 | IL12-mediated signaling events | |||||
| Reactome | [+] 3 Reactome Pathways | + | ||||
| 1 | Binding and entry of HIV virion | |||||
| 2 | Chemokine receptors bind chemokines | |||||
| 3 | G alpha (i) signalling events | |||||
| WikiPathways | [+] 7 WikiPathways | + | ||||
| 1 | TCR Signaling Pathway | |||||
| 2 | GPCRs, Class A Rhodopsin-like | |||||
| 3 | HIV Life Cycle | |||||
| 4 | Peptide GPCRs | |||||
| 5 | GPCR ligand binding | |||||
| 6 | GPCR downstream signaling | |||||
| 7 | GPCRs, Other | |||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Molecular cloning and radioligand binding characterization of the chemokine receptor CCR5 from rhesus macaque and human. Biochem Pharmacol. 2005 Dec 19;71(1-2):163-72. | |||||
| REF 2 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 806). | |||||
| REF 3 | 2007 FDA drug approvals: a year of flux. Nat Rev Drug Discov. 2008 Feb;7(2):107-9. | |||||
| REF 4 | Emerging drugs for the treatment of chronic obstructive pulmonary disease. Expert Opin Emerg Drugs. 2006 May;11(2):275-91. | |||||
| REF 5 | Clinical pipeline report, company report or official report of Benitec Ltd. | |||||
| REF 6 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 804). | |||||
| REF 7 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800014207) | |||||
| REF 8 | Progress on RNAi-based molecular medicines. Int J Nanomedicine. 2012; 7: 3971-3980. | |||||
| REF 9 | Discovery and characterization of vicriviroc (SCH 417690), a CCR5 antagonist with potent activity against human immunodeficiency virus type 1. Antimicrob Agents Chemother. 2005 Dec;49(12):4911-9. | |||||
| REF 10 | A broad-spectrum chemokine antagonist encoded by Kaposi's sarcoma-associated herpesvirus. Science. 1997 Sep 12;277(5332):1656-9. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.