Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T57700
(Former ID: TTDS00270)
|
|||||
Target Name |
Tyrosine-protein kinase Kit (KIT)
|
|||||
Synonyms |
v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog; p145 c-kit; Proto-oncogene tyrosine-protein kinase Kit; Proto-oncogene c-Kit; Piebald trait protein; PBT; Mast/stem cell growth factor receptor Kit; CD117 antigen; CD117; C-kit
|
|||||
Gene Name |
KIT
|
|||||
Target Type |
Successful target
|
[1] | ||||
Disease | [+] 7 Target-related Diseases | + | ||||
1 | Bone/articular cartilage neoplasm [ICD-11: 2F7B] | |||||
2 | Colorectal cancer [ICD-11: 2B91] | |||||
3 | Gastrointestinal stromal tumour [ICD-11: 2B5B] | |||||
4 | Mature B-cell lymphoma [ICD-11: 2A85] | |||||
5 | Myeloproliferative neoplasm [ICD-11: 2A20] | |||||
6 | Renal cell carcinoma [ICD-11: 2C90] | |||||
7 | Thrombocytopenia [ICD-11: 3B64] | |||||
Function |
In response to KITLG/SCF binding, KIT can activate several signaling pathways. Phosphorylates PIK3R1, PLCG1, SH2B2/APS and CBL. Activates the AKT1 signaling pathway by phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase. Activated KIT also transmits signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. Promotes activation of STAT family members STAT1, STAT3, STAT5A and STAT5B. Activation of PLCG1 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KIT signaling is modulated by protein phosphatases, and by rapid internalization and degradation of the receptor. Activated KIT promotes phosphorylation of the protein phosphatases PTPN6/SHP-1 and PTPRU, and of the transcription factors STAT1, STAT3, STAT5A and STAT5B. Promotes phosphorylation of PIK3R1, CBL, CRK (isoform Crk-II), LYN, MAPK1/ERK2 and/or MAPK3/ERK1, PLCG1, SRC and SHC1. Tyrosine-protein kinase that acts as cell-surface receptor for the cytokine KITLG/SCF and plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis.
Click to Show/Hide
|
|||||
BioChemical Class |
Kinase
|
|||||
UniProt ID | ||||||
EC Number |
EC 2.7.10.1
|
|||||
Sequence |
MRGARGAWDFLCVLLLLLRVQTGSSQPSVSPGEPSPPSIHPGKSDLIVRVGDEIRLLCTD
PGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLV DRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYH RLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLREGEEFTVTCTIKDVSS SVYSTWKRENSQTKLQEKYNSWHHGDFNYERQATLTISSARVNDSGVFMCYANNTFGSAN VTTTLEVVDKGFINIFPMINTTVFVNDGENVDLIVEYEAFPKPEHQQWIYMNRTFTDKWE DYPKSENESNIRYVSELHLTRLKGTEGGTYTFLVSNSDVNAAIAFNVYVNTKPEILTYDR LVNGMLQCVAAGFPEPTIDWYFCPGTEQRCSASVLPVDVQTLNSSGPPFGKLVVQSSIDS SAFKHNGTVECKAYNDVGKTSAYFNFAFKGNNKEQIHPHTLFTPLLIGFVIVAGMMCIIV MILTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAF GKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLGAC TIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAEAALYKNLLHSKESSCSDSTNE YMDMKPGVSYVVPTKADKRRSVRIGSYIERDVTPAIMEDDELALDLEDLLSFSYQVAKGM AFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPES IFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMY DIMKTCWDADPLKRPTFKQIVQLIEKQISESTNHIYSNLANCSPNRQKPVVDHSVRINSV GSTASSSQPLLVHDDV Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
HIT2.0 ID | T76PKX |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Approved Drug(s) | [+] 8 Approved Drugs | + | ||||
1 | Imatinib | Drug Info | Approved | Chronic myelogenous leukaemia | [2], [3] | |
2 | Pazopanib HCl | Drug Info | Approved | Renal cell carcinoma | [4] | |
3 | Pexidartinib | Drug Info | Approved | Tenosynovial giant cell tumour | [5] | |
4 | Ponatinib | Drug Info | Approved | Acute lymphoblastic leukaemia | [6], [7] | |
5 | Regorafenib | Drug Info | Approved | Metastatic colorectal cancer | [7], [8] | |
6 | Ripretinib | Drug Info | Approved | Gastrointestinal stromal tumour | [9] | |
7 | Romiplostim | Drug Info | Approved | Thrombocytopenia | [10], [11] | |
8 | Sorafenib | Drug Info | Approved | Renal cell carcinoma | [12], [13] | |
Clinical Trial Drug(s) | [+] 7 Clinical Trial Drugs | + | ||||
1 | Famitinib | Drug Info | Phase 2 | Solid tumour/cancer | [14], [15] | |
2 | MP470 | Drug Info | Phase 2 | Solid tumour/cancer | [16], [17], [18] | |
3 | XL-820 | Drug Info | Phase 2 | Solid tumour/cancer | [19] | |
4 | PLX9486 | Drug Info | Phase 1/2 | Gastrointestinal stromal tumour | [20] | |
5 | AMG-191 | Drug Info | Phase 1 | Inflammation | [21] | |
6 | CART-117 cells | Drug Info | Phase 1 | Myelodysplastic syndrome | [22] | |
7 | OSI-930 | Drug Info | Phase 1 | Solid tumour/cancer | [23], [24] | |
Discontinued Drug(s) | [+] 1 Discontinued Drugs | + | ||||
1 | Motesanib | Drug Info | Discontinued in Phase 3 | Non-small-cell lung cancer | [25], [26] | |
Preclinical Drug(s) | [+] 1 Preclinical Drugs | + | ||||
1 | CAR-T cells targeting CD117 | Drug Info | Preclinical | Acute myeloid leukaemia | [27] | |
Mode of Action | [+] 3 Modes of Action | + | ||||
Inhibitor | [+] 34 Inhibitor drugs | + | ||||
1 | Imatinib | Drug Info | [1] | |||
2 | Pazopanib HCl | Drug Info | [4] | |||
3 | Pexidartinib | Drug Info | [5] | |||
4 | Ripretinib | Drug Info | [9] | |||
5 | Romiplostim | Drug Info | [29] | |||
6 | Famitinib | Drug Info | [15] | |||
7 | XL-820 | Drug Info | [31] | |||
8 | PLX9486 | Drug Info | [32] | |||
9 | AMG-191 | Drug Info | [33] | |||
10 | PMID25656651-Compound-21a | Drug Info | [34] | |||
11 | PMID25656651-Compound-21b | Drug Info | [34] | |||
12 | Pyridine derivative 18 | Drug Info | [35] | |||
13 | Pyridine derivative 19 | Drug Info | [35] | |||
14 | Pyridine derivative 20 | Drug Info | [35] | |||
15 | Pyridine derivative 21 | Drug Info | [35] | |||
16 | Pyridine derivative 22 | Drug Info | [35] | |||
17 | Motesanib | Drug Info | [36], [37], [38] | |||
18 | 4-(4-aminophenyl)-1H-indazol-3yl-amine | Drug Info | [39] | |||
19 | 5,11-Dimethyl-6H-pyrido[4,3-b]carbazol-9-ol | Drug Info | [40] | |||
20 | 9-Bromo-5,11-dimethyl-6H-pyrido[4,3-b]carbazole | Drug Info | [40] | |||
21 | 9-Methoxy-5,11-dimethyl-6H-pyrido[4,3-b]carbazole | Drug Info | [40] | |||
22 | APCK-110 | Drug Info | [41] | |||
23 | AST-487 | Drug Info | [42] | |||
24 | Bis-(5-hydroxy-1H-indol-2-yl)-methanone | Drug Info | [43] | |||
25 | CP-673451 | Drug Info | [44] | |||
26 | GTP-14564 | Drug Info | [45] | |||
27 | JNJ-28312141 | Drug Info | [46] | |||
28 | Ki-20227 | Drug Info | [47] | |||
29 | PD-0166326 | Drug Info | [48] | |||
30 | PD-0173956 | Drug Info | [48] | |||
31 | Phosphonotyrosine | Drug Info | [49] | |||
32 | PMID22765894C8h | Drug Info | [50] | |||
33 | PMID23521020C7k | Drug Info | [51] | |||
34 | WBZ-7 | Drug Info | [41] | |||
Modulator | [+] 5 Modulator drugs | + | ||||
1 | Ponatinib | Drug Info | [28] | |||
2 | Regorafenib | Drug Info | [28] | |||
3 | Sorafenib | Drug Info | [13], [30] | |||
4 | MP470 | Drug Info | [17], [18] | |||
5 | OSI-930 | Drug Info | [23], [24] | |||
CAR-T-Cell-Therapy | [+] 2 CAR-T-Cell-Therapy drugs | + | ||||
1 | CART-117 cells | Drug Info | [22] | |||
2 | CAR-T cells targeting CD117 | Drug Info | [27] |
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Co-Targets | Top | |||||
---|---|---|---|---|---|---|
Co-Targets |
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-regulating microRNAs | ||||||
Target-interacting Proteins |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) | ||||||
Drug Resistance Mutation (DRM) |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | A comparison of physicochemical property profiles of marketed oral drugs and orally bioavailable anti-cancer protein kinase inhibitors in clinical development. Curr Top Med Chem. 2007;7(14):1408-22. | |||||
REF 2 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5687). | |||||
REF 3 | Emerging treatments for pulmonary arterial hypertension. Expert Opin Emerg Drugs. 2006 Nov;11(4):609-19. | |||||
REF 4 | Hughes B: 2009 FDA drug approvals. Nat Rev Drug Discov. 2010 Feb;9(2):89-92. | |||||
REF 5 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health Human Services. 2019 | |||||
REF 6 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5890). | |||||
REF 7 | Nat Rev Drug Discov. 2013 Feb;12(2):87-90. | |||||
REF 8 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5891). | |||||
REF 9 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health Human Services. 2020 | |||||
REF 10 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6974). | |||||
REF 11 | 2008 FDA drug approvals. Nat Rev Drug Discov. 2009 Feb;8(2):93-6. | |||||
REF 12 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5711). | |||||
REF 13 | Sorafenib (BAY 43-9006, Nexavar), a dual-action inhibitor that targets RAF/MEK/ERK pathway in tumor cells and tyrosine kinases VEGFR/PDGFR in tumor vasculature. Methods Enzymol. 2006;407:597-612. | |||||
REF 14 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7886). | |||||
REF 15 | Metabolism and bioactivation of famitinib, a novel inhibitor of receptor tyrosine kinase, in cancer patients. Br J Pharmacol. 2013 Apr;168(7):1687-706. | |||||
REF 16 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7932). | |||||
REF 17 | Phase 1B study of amuvatinib in combination with five standard cancer therapies in adults with advanced solid tumors. Cancer Chemother Pharmacol. 2014 Jul;74(1):195-204. | |||||
REF 18 | The receptor tyrosine kinase inhibitor amuvatinib (MP470) sensitizes tumor cells to radio- and chemo-therapies in part by inhibiting homologous recombination. Radiother Oncol. 2011 Oct;101(1):59-65. | |||||
REF 19 | ClinicalTrials.gov (NCT00570635) A Phase 2 Study of XL820 in Adults With Advanced GIST Resistant to Imatinib and/or Sunitinib. U.S. National Institutes of Health. | |||||
REF 20 | ClinicalTrials.gov (NCT02401815) CGT9486 (Formerly Known as PLX9486) as a Single Agent and in Combination With PLX3397 (Pexidartinib) or Sunitinib in Participants With Advanced Solid Tumors. U.S. National Institutes of Health. | |||||
REF 21 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800029529) | |||||
REF 22 | ClinicalTrials.gov (NCT03291444) CAR-T Cells Combined With Peptide Specific Dendritic Cell in Relapsed/Refractory Leukemia/MDS | |||||
REF 23 | OSI-930 analogues as novel reversal agents for ABCG2-mediated multidrug resistance. Biochem Pharmacol. 2012 Sep 15;84(6):766-74. | |||||
REF 24 | Inhibition of c-Kit, VEGFR-2 (KDR), and ABCG2 by analogues of OSI-930. Bioorg Med Chem Lett. 2011 Nov 1;21(21):6495-9. | |||||
REF 25 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5660). | |||||
REF 26 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800011016) | |||||
REF 27 | ClinicalTrials.gov (NCT03473457) CAR-T Cells Therapy in Relapsed/Refractory Acute Myeloid Leukemia | |||||
REF 28 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
REF 29 | New anilinophthalazines as potent and orally well absorbed inhibitors of the VEGF receptor tyrosine kinases useful as antagonists of tumor-driven a... J Med Chem. 2000 Jun 15;43(12):2310-23. | |||||
REF 30 | Preclinical overview of sorafenib, a multikinase inhibitor that targets both Raf and VEGF and PDGF receptor tyrosine kinase signaling.Mol Cancer Ther.2008 Oct;7(10):3129-40. | |||||
REF 31 | National Cancer Institute Drug Dictionary (drug id 452042). | |||||
REF 32 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 33 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800029529) | |||||
REF 34 | Bcr-Abl tyrosine kinase inhibitors: a patent review.Expert Opin Ther Pat. 2015 Apr;25(4):397-412. | |||||
REF 35 | RET kinase inhibitors: a review of recent patents (2012-2015).Expert Opin Ther Pat. 2017 Jan;27(1):91-99. | |||||
REF 36 | Clinical pipeline report, company report or official report of Amgen (2009). | |||||
REF 37 | Phase II study of safety and efficacy of motesanib in patients with progressive or symptomatic, advanced or metastatic medullary thyroid cancer. J Clin Oncol. 2009 Aug 10;27(23):3794-801. | |||||
REF 38 | Axitinib for renal cell carcinoma. Expert Opin Investig Drugs. 2008 May;17(5):741-8. | |||||
REF 39 | Discovery of N-(4-(3-amino-1H-indazol-4-yl)phenyl)-N'-(2-fluoro-5-methylphenyl)urea (ABT-869), a 3-aminoindazole-based orally active multitargeted ... J Med Chem. 2007 Apr 5;50(7):1584-97. | |||||
REF 40 | Molecular modeling of wild-type and D816V c-Kit inhibition based on ATP-competitive binding of ellipticine derivatives to tyrosine kinases. J Med Chem. 2005 Oct 6;48(20):6194-201. | |||||
REF 41 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1805). | |||||
REF 42 | The RET kinase inhibitor NVP-AST487 blocks growth and calcitonin gene expression through distinct mechanisms in medullary thyroid cancer cells. Cancer Res. 2007 Jul 15;67(14):6956-64. | |||||
REF 43 | Novel bis(1H-indol-2-yl)methanones as potent inhibitors of FLT3 and platelet-derived growth factor receptor tyrosine kinase. J Med Chem. 2006 Jun 1;49(11):3101-15. | |||||
REF 44 | Antiangiogenic and antitumor activity of a selective PDGFR tyrosine kinase inhibitor, CP-673,451. Cancer Res. 2005 Feb 1;65(3):957-66. | |||||
REF 45 | Selective cytotoxic mechanism of GTP-14564, a novel tyrosine kinase inhibitor in leukemia cells expressing a constitutively active Fms-like tyrosin... J Biol Chem. 2003 Aug 29;278(35):32892-8. | |||||
REF 46 | JNJ-28312141, a novel orally active colony-stimulating factor-1 receptor/FMS-related receptor tyrosine kinase-3 receptor tyrosine kinase inhibitor with potential utility in solid tumors, bone metastases, and acute myeloid leukemia. Mol Cancer Ther. 2009 Nov;8(11):3151-61. | |||||
REF 47 | A c-fms tyrosine kinase inhibitor, Ki20227, suppresses osteoclast differentiation and osteolytic bone destruction in a bone metastasis model. Mol Cancer Ther. 2006 Nov;5(11):2634-43. | |||||
REF 48 | Structure-activity relationships of 6-(2,6-dichlorophenyl)-8-methyl-2-(phenylamino)pyrido[2,3-d]pyrimidin-7-ones: toward selective Abl inhibitors. Bioorg Med Chem Lett. 2009 Dec 15;19(24):6872-6. | |||||
REF 49 | How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | |||||
REF 50 | The design, synthesis, and biological evaluation of potent receptor tyrosine kinase inhibitors. Bioorg Med Chem Lett. 2012 Aug 1;22(15):4979-85. | |||||
REF 51 | Discovery and optimization of 3-(2-(Pyrazolo[1,5-a]pyrimidin-6-yl)ethynyl)benzamides as novel selective and orally bioavailable discoidin domain receptor 1 (DDR1) inhibitors. J Med Chem. 2013 Apr 25;56(8):3281-95. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.