Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T57613
(Former ID: TTDR01198)
|
|||||
Target Name |
TWIK-related acid-sensitive potassium channel 3 (TASK3)
|
|||||
Synonyms |
Two pore potassium channel KT3.2; TWIK-related acid-sensitive K+ channel 3; KCNK9; Acid-sensitive potassium channel protein TASK-3
Click to Show/Hide
|
|||||
Gene Name |
KCNK9
|
|||||
Target Type |
Literature-reported target
|
[1] | ||||
Function |
pH-dependent, voltage-insensitive, background potassium channel protein.
Click to Show/Hide
|
|||||
UniProt ID | ||||||
Sequence |
MKRQNVRTLSLIVCTFTYLLVGAAVFDALESDHEMREEEKLKAEEIRIKGKYNISSEDYR
QLELVILQSEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPL TLVMFQSLGERMNTFVRYLLKRIKKCCGMRNTDVSMENMVTVGFFSCMGTLCIGAAAFSQ CEEWSFFHAYYYCFITLTTIGFGDYVALQTKGALQKKPLYVAFSFMYILVGLTVIGAFLN LVVLRFLTMNSEDERRDAEERASLAGNRNSMVIHIPEEPRPSRPRYKADVPDLQSVCSCT CYRSQDYGGRSVAPQNSFSAKLAPHYFHSISYKIEEISPSTLKNSLFPSPISSISPGLHS FTDHQRLMKRRKSV Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold |
Cell-based Target Expression Variations | Top | |||||
---|---|---|---|---|---|---|
Cell-based Target Expression Variations |
Drug Binding Sites of Target | Top | |||||
---|---|---|---|---|---|---|
Ligand Name: L-serine-O-phosphate | Ligand Info | |||||
Structure Description | Crystal structure of human 14-3-3 sigma C38N/N166H in complex with TASK-3 peptide and stabilizer fusicoccin A | PDB:3P1S | ||||
Method | X-ray diffraction | Resolution | 1.65 Å | Mutation | Yes | [2] |
PDB Sequence |
KRRKV
|
|||||
|
||||||
Click to View More Binding Site Information of This Target and Ligand Pair | ||||||
Ligand Name: N-[(2S)-2-[(1E,3R,4S,8R,9R,10R,11S,14S)-4,9-dihydroxy-14-(methoxymethyl)-3,10-dimethyl-8-[(2S,3R,4S,5S,6R)-3,4,5-trihydroxy-6-(2-methylbut-3-en-2-yloxymethyl)oxan-2-yl]oxy-6-tricyclo[9.3.0.03,7]tetradeca-1,6-dienyl]propyl]acetamide | Ligand Info | |||||
Structure Description | 14-3-3sigma in complex with a TASK3 peptide stabilized by semi-synthetic natural product FC-NAc | PDB:6GHP | ||||
Method | X-ray diffraction | Resolution | 1.95 Å | Mutation | No | [3] |
PDB Sequence |
RRKV
|
|||||
|
||||||
Click to View More Binding Site Information of This Target with Different Ligands |
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Pathway Affiliation
of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function.
Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes
(Pharmacol Rev, 58: 259-279, 2006).
Human Similarity Proteins
Human Pathway Affiliation
|
Protein Name | Pfam ID | Percentage of Identity (%) | E value |
---|---|---|---|
Voltage-gated potassium channel Kv10.2 (KCNH5) | 39.130 (18/46) | 2.00E-03 |
KEGG Pathway | Pathway ID | Affiliated Target | Pathway Map |
---|---|---|---|
Aldosterone synthesis and secretion | hsa04925 | Affiliated Target |
|
Class: Organismal Systems => Endocrine system | Pathway Hierarchy |
Chemical Structure based Activity Landscape of Target | Top |
---|---|
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Oncogenic potential of TASK3 (Kcnk9) depends on K+ channel function. Proc Natl Acad Sci U S A. 2003 Jun 24;100(13):7803-7. | |||||
REF 2 | A semisynthetic fusicoccane stabilizes a protein-protein interaction and enhances the expression of K+ channels at the cell surface. Chem Biol. 2013 Apr 18;20(4):583-93. | |||||
REF 3 | Rationally Designed Semisynthetic Natural Product Analogues for Stabilization of 14-3-3 Protein-Protein Interactions. Angew Chem Int Ed Engl. 2018 Oct 8;57(41):13470-13474. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.