Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T54761
(Former ID: TTDI02324)
|
|||||
Target Name |
Myelin basic protein (MBP)
|
|||||
Synonyms |
Myelin membrane encephalitogenic protein; Myelin A1 protein
Click to Show/Hide
|
|||||
Gene Name |
MBP
|
|||||
Target Type |
Clinical trial target
|
[1] | ||||
Disease | [+] 1 Target-related Diseases | + | ||||
1 | Multiple sclerosis [ICD-11: 8A40] | |||||
Function |
The classic group of MBP isoforms (isoform 4-isoform 14) are with PLP the most abundant protein components of the myelin membrane in the CNS. They have a role in both its formation and stabilization. The smaller isoforms might have an important role in remyelination of denuded axons in multiple sclerosis. The non-classic group of MBP isoforms (isoform 1-isoform 3/Golli-MBPs) may preferentially have a role in the early developing brain long before myelination, maybe as components of transcriptional complexes, and may also be involved in signaling pathways in T-cells and neural cells. Differential splicing events combined with optional post-translational modifications give a wide spectrum of isomers, with each of them potentially having a specialized function. Induces T-cell proliferation.
Click to Show/Hide
|
|||||
UniProt ID | ||||||
Sequence |
MGNHAGKRELNAEKASTNSETNRGESEKKRNLGELSRTTSEDNEVFGEADANQNNGTSSQ
DTAVTDSKRTADPKNAWQDAHPADPGSRPHLIRLFSRDAPGREDNTFKDRPSESDELQTI QEDSAATSESLDVMASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFG GDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKG RGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSP MARR Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
ADReCS ID | BADD_A05725 | |||||
HIT2.0 ID | T83VW4 |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 2 Clinical Trial Drugs | + | ||||
1 | BHT-3009 | Drug Info | Phase 2 | Multiple sclerosis | [2] | |
2 | NBI-5788 | Drug Info | Phase 2 | Multiple sclerosis | [3] | |
Mode of Action | [+] 1 Modes of Action | + | ||||
Binder | [+] 1 Binder drugs | + | ||||
1 | NBI-5788 | Drug Info | [1] |
Cell-based Target Expression Variations | Top | |||||
---|---|---|---|---|---|---|
Cell-based Target Expression Variations |
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Tissue Distribution
of target is determined from a proteomics study that quantified more than 12,000 genes across 32 normal human tissues. Tissue Specificity (TS) score was used to define the enrichment of target across tissues.
The distribution of targets among different tissues or organs need to be taken into consideration when assessing the target druggability, as it is generally accepted that the wider the target distribution, the greater the concern over potential adverse effects
(Nat Rev Drug Discov, 20: 64-81, 2021).
Biological Network Descriptors
of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database.
The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information
(Front Pharmacol, 9, 1245, 2018;
Curr Opin Struct Biol. 44:134-142, 2017).
Human Similarity Proteins
Human Tissue Distribution
Biological Network Descriptors
|
There is no similarity protein (E value < 0.005) for this target
|
Note:
If a protein has TS (tissue specficity) scores at least in one tissue >= 2.5, this protein is called tissue-enriched (including tissue-enriched-but-not-specific and tissue-specific). In the plots, the vertical lines are at thresholds 2.5 and 4.
|
Degree | 2 | Degree centrality | 2.15E-04 | Betweenness centrality | 0.00E+00 |
---|---|---|---|---|---|
Closeness centrality | 1.70E-01 | Radiality | 1.27E+01 | Clustering coefficient | 1.00E+00 |
Neighborhood connectivity | 8.50E+00 | Topological coefficient | 7.08E-01 | Eccentricity | 13 |
Download | Click to Download the Full PPI Network of This Target | ||||
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-interacting Proteins |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
WikiPathways | [+] 5 WikiPathways | + | ||||
1 | MAPK Cascade | |||||
2 | Structural Pathway of Interleukin 1 (IL-1) | |||||
3 | Spinal Cord Injury | |||||
4 | Glial Cell Differentiation | |||||
5 | Neural Crest Differentiation |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | NBI-5788, an altered MBP83-99 peptide, induces a T-helper 2-like immune response in multiple sclerosis patients. Ann Neurol. 2000 Nov;48(5):758-65. | |||||
REF 2 | ClinicalTrials.gov (NCT00382629) BHT-3009 Immunotherapy in Relapsing Remitting Multiple Sclerosis. U.S. National Institutes of Health. | |||||
REF 3 | ClinicalTrials.gov (NCT00001781) Safety, Tolerability, and Effectiveness of CGP77116 in Patients With Multiple Sclerosis (MS). U.S. National Institutes of Health. | |||||
REF 4 | BHT-3009, a myelin basic protein-encoding plasmid for the treatment of multiple sclerosis. Curr Opin Mol Ther. 2009 Aug;11(4):463-70. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.