Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T54761
(Former ID: TTDI02324)
|
|||||
Target Name |
Myelin basic protein (MBP)
|
|||||
Synonyms |
Myelin membrane encephalitogenic protein; Myelin A1 protein
|
|||||
Gene Name |
MBP
|
|||||
Target Type |
Clinical trial target
|
[1] | ||||
Disease | [+] 1 Target-related Diseases | + | ||||
1 | Multiple sclerosis [ICD-11: 8A40] | |||||
Function |
The classic group of MBP isoforms (isoform 4-isoform 14) are with PLP the most abundant protein components of the myelin membrane in the CNS. They have a role in both its formation and stabilization. The smaller isoforms might have an important role in remyelination of denuded axons in multiple sclerosis. The non-classic group of MBP isoforms (isoform 1-isoform 3/Golli-MBPs) may preferentially have a role in the early developing brain long before myelination, maybe as components of transcriptional complexes, and may also be involved in signaling pathways in T-cells and neural cells. Differential splicing events combined with optional post-translational modifications give a wide spectrum of isomers, with each of them potentially having a specialized function. Induces T-cell proliferation.
Click to Show/Hide
|
|||||
UniProt ID | ||||||
Sequence |
MGNHAGKRELNAEKASTNSETNRGESEKKRNLGELSRTTSEDNEVFGEADANQNNGTSSQ
DTAVTDSKRTADPKNAWQDAHPADPGSRPHLIRLFSRDAPGREDNTFKDRPSESDELQTI QEDSAATSESLDVMASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFG GDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKG RGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSP MARR Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
ADReCS ID | BADD_A05725 | |||||
HIT2.0 ID | T83VW4 |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 2 Clinical Trial Drugs | + | ||||
1 | BHT-3009 | Drug Info | Phase 2 | Multiple sclerosis | [2] | |
2 | NBI-5788 | Drug Info | Phase 2 | Multiple sclerosis | [3] | |
Mode of Action | [+] 1 Modes of Action | + | ||||
Binder | [+] 1 Binder drugs | + | ||||
1 | NBI-5788 | Drug Info | [1] |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-interacting Proteins |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
WikiPathways | [+] 5 WikiPathways | + | ||||
1 | MAPK Cascade | |||||
2 | Structural Pathway of Interleukin 1 (IL-1) | |||||
3 | Spinal Cord Injury | |||||
4 | Glial Cell Differentiation | |||||
5 | Neural Crest Differentiation |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | NBI-5788, an altered MBP83-99 peptide, induces a T-helper 2-like immune response in multiple sclerosis patients. Ann Neurol. 2000 Nov;48(5):758-65. | |||||
REF 2 | ClinicalTrials.gov (NCT00382629) BHT-3009 Immunotherapy in Relapsing Remitting Multiple Sclerosis. U.S. National Institutes of Health. | |||||
REF 3 | ClinicalTrials.gov (NCT00001781) Safety, Tolerability, and Effectiveness of CGP77116 in Patients With Multiple Sclerosis (MS). U.S. National Institutes of Health. | |||||
REF 4 | BHT-3009, a myelin basic protein-encoding plasmid for the treatment of multiple sclerosis. Curr Opin Mol Ther. 2009 Aug;11(4):463-70. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.