Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T52953
(Former ID: TTDC00216)
|
|||||
| Target Name |
CRP messenger RNA (CRP mRNA)
|
|||||
| Synonyms |
PTX1 (mRNA); C-reactive protein (mRNA)
Click to Show/Hide
|
|||||
| Gene Name |
CRP
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 3 Target-related Diseases | + | ||||
| 1 | Coronary atherosclerosis [ICD-11: BA80] | |||||
| 2 | Cardiovascular disease [ICD-11: BA00-BE2Z] | |||||
| 3 | Postoperative inflammation [ICD-11: 1A00-CA43] | |||||
| Function |
Can interact with DNA and histones and may scavenge nuclear material released from damaged circulating cells. Displays several functions associated with host defense: it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine.
Click to Show/Hide
|
|||||
| BioChemical Class |
mRNA target
|
|||||
| UniProt ID | ||||||
| Sequence |
MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTE
LSSTRGYSIFSYATKRQDNEILIFWSKDIGYSFTVGGSEILFEVPEVTVAPVHICTSWES ASGIVEFWVDGKPRVRKSLKKGYTVGAEASIILGQEQDSFGGNFEGSQSLVGDIGNVNMW DFVLSPDEINTIYLGGPFSPNVLNWRALKYEVQGEVFTKPQLWP Click to Show/Hide
|
|||||
| HIT2.0 ID | T90XYZ | |||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 2 Clinical Trial Drugs | + | ||||
| 1 | ISIS-CRPRx | Drug Info | Phase 2 | Coronary artery disease | [2] | |
| 2 | ISIS-CRP | Drug Info | Phase 1 | Inflammation | [3] | |
| Mode of Action | [+] 2 Modes of Action | + | ||||
| Modulator | [+] 1 Modulator drugs | + | ||||
| 1 | ISIS-CRPRx | Drug Info | [1] | |||
| Inhibitor | [+] 1 Inhibitor drugs | + | ||||
| 1 | Phosphocholine | Drug Info | [6] | |||
| Cell-based Target Expression Variations | Top | |||||
|---|---|---|---|---|---|---|
| Cell-based Target Expression Variations | ||||||
| Target Regulators | Top | |||||
|---|---|---|---|---|---|---|
| Target-regulating Transcription Factors | ||||||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| NetPath Pathway | [+] 1 NetPath Pathways | + | ||||
| 1 | Leptin Signaling Pathway | |||||
| PID Pathway | [+] 1 PID Pathways | + | ||||
| 1 | IL6-mediated signaling events | |||||
| WikiPathways | [+] 6 WikiPathways | + | ||||
| 1 | IL-6 signaling pathway | |||||
| 2 | Human Complement System | |||||
| 3 | Complement cascade | |||||
| 4 | Folate Metabolism | |||||
| 5 | Vitamin B12 Metabolism | |||||
| 6 | Selenium Micronutrient Network | |||||
| Target-Related Models and Studies | Top | |||||
|---|---|---|---|---|---|---|
| Target Validation | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Antisense oligonucleotides on neurobehavior, respiratory, and cardiovascular function, and hERG channel current studies. J Pharmacol Toxicol Methods. 2014 Jan-Feb;69(1):49-60. | |||||
| REF 2 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800024563) | |||||
| REF 3 | Clinical pipeline report, company report or official report of ISIS Pharmaceuticals (2011). | |||||
| REF 4 | Clinical pipeline report, company report or official report of ISIS Pharmaceuticals (2009). | |||||
| REF 5 | US patent application no. 7,425,545, Modulation of C-reactive protein expression. | |||||
| REF 6 | How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.