Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T52771
(Former ID: TTDNS00614)
|
|||||
| Target Name |
Mycobacterium Proton pump (MycB Prop)
|
|||||
| Synonyms |
Nicotinamide nucleotide transhydrogenase subunit beta; NAD(P) transhydrogenase subunit beta
Click to Show/Hide
|
|||||
| Gene Name |
MycB Prop
|
|||||
| Target Type |
Successful target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Antimicrobial drug resistance [ICD-11: MG50-MG52] | |||||
| Function |
The transhydrogenation between NADH and NADP is coupled to respiration and ATP hydrolysis and functions as a proton pump across the membrane.
Click to Show/Hide
|
|||||
| UniProt ID | ||||||
| Sequence |
MNYLVTVLYIISFALFIYGLMGLTGPKTAVRGNLIAAVGMAIAVAATLIKIRHTESWVLI
IAGLVVGVALGVPPARYTKMTAMPQLVAFFNGVGGGTVALIALSEFIETKGFSAFQHGES PTVHIVVASLFAAIIGSISFWGSIIAFGKLQEIISGSPIGFGKAQQPINLLLLAAAVAAA VVIGLGAHPGTGGVALWWMIGLLAAAGVLGLMVVLPIGGADMPVVISLLNAMTGLSAAAA GLALNNTAMIVAGMIVGASGSILTNLMAKAMNRSIPAIVAGGFGGGGVAPSGGGGGDKHV KATSAADAAIQMAYANQVIVVPGYGLAVAQAQHAVKDMASLLEDKGVPVKYAIHPVAGRM PGHMNVLLAEAEVDYDAMKDMDDINDEFARTDVAIVIGANDVTNPAARNEQSSPIYGMPI LNVDRAKSVIVLKRSMNSGFAGIDNPLFYADGTTMLFGDAKKSVTEVAEELKAL Click to Show/Hide
|
|||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Approved Drug(s) | [+] 1 Approved Drugs | + | ||||
| 1 | Bedaquiline | Drug Info | Approved | Multi-drug resistant tuberculosis | [1], [2] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| Modulator | [+] 1 Modulator drugs | + | ||||
| 1 | Bedaquiline | Drug Info | [1] | |||
| Different Human System Profiles of Target | Top |
|---|---|
|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
|
|
There is no similarity protein (E value < 0.005) for this target
|
| Co-Targets | Top | |||||
|---|---|---|---|---|---|---|
| Co-Targets | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
| REF 2 | Nat Rev Drug Discov. 2013 Feb;12(2):87-90. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.