Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T42854
(Former ID: TTDI02338)
|
|||||
| Target Name |
Melanoma-associated antigen 1 (MAGEA1)
|
|||||
| Synonyms |
Melanomaassociated antigen 1; MAGE1A; MAGE1 antigen; MAGE1; MAGE-1 antigen; Cancer/testis antigen 1.1; CT1.1; Antigen MZ2E; Antigen MZ2-E
Click to Show/Hide
|
|||||
| Gene Name |
MAGEA1
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Lung cancer [ICD-11: 2C25] | |||||
| Function |
May inhibit notch intracellular domain (NICD) transactivation. May play a role in embryonal development and tumor transformation or aspects of tumor progression. Antigen recognized on a melanoma by autologous cytolytic T-lymphocytes. May be involved in transcriptional regulation through interaction with SNW1 and recruiting histone deactelyase HDAC1.
Click to Show/Hide
|
|||||
| BioChemical Class |
Melanoma associated antigen
|
|||||
| UniProt ID | ||||||
| Sequence |
MSLEQRSLHCKPEEALEAQQEALGLVCVQAATSSSSPLVLGTLEEVPTAGSTDPPQSPQG
ASAFPTTINFTRQRQPSEGSSSREEEGPSTSCILESLFRAVITKKVADLVGFLLLKYRAR EPVTKAEMLESVIKNYKHCFPEIFGKASESLQLVFGIDVKEADPTGHSYVLVTCLGLSYD GLLGDNQIMPKTGFLIIVLVMIAMEGGHAPEEEIWEELSVMEVYDGREHSAYGEPRKLLT QDLVQEKYLEYRQVPDSDPARYEFLWGPRALAETSYVKVLEYVIKVSARVRFFFPSLREA ALREEEEGV Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 1 Clinical Trial Drugs | + | ||||
| 1 | CAR-T cells targeting MAGE-A1 | Drug Info | Phase 1/2 | Lung cancer | [1] | |
| Discontinued Drug(s) | [+] 1 Discontinued Drugs | + | ||||
| 1 | Melanoma vaccine (ALVAC) | Drug Info | Discontinued in Phase 2 | Melanoma | [2] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| CAR-T-Cell-Therapy | [+] 1 CAR-T-Cell-Therapy drugs | + | ||||
| 1 | CAR-T cells targeting MAGE-A1 | Drug Info | [1] | |||
| Cell-based Target Expression Variations | Top | |||||
|---|---|---|---|---|---|---|
| Cell-based Target Expression Variations | ||||||
| Different Human System Profiles of Target | Top |
|---|---|
|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
|
| Protein Name | Pfam ID | Percentage of Identity (%) | E value |
|---|---|---|---|
| Melanoma-associated antigen C2 (MAGEC2) | 50.233 (108/215) | 2.59E-57 | |
| Melanoma-associated antigen C3 (MAGEC3) | 55.118 (70/127) | 8.64E-37 | |
| Target Regulators | Top | |||||
|---|---|---|---|---|---|---|
| Target-interacting Proteins | ||||||
| Target Profiles in Patients | Top | |||||
|---|---|---|---|---|---|---|
| Target Expression Profile (TEP) | ||||||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| WikiPathways | [+] 1 WikiPathways | + | ||||
| 1 | Notch Signaling Pathway | |||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | ClinicalTrials.gov (NCT03356808) Antigen-specific T Cells Against Lung Cancer | |||||
| REF 2 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800014153) | |||||
| REF 3 | Preclinical qualification of a new multi-antigen candidate vaccine for metastatic melanoma. J Immunother. 2010 Oct;33(8):743-58. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.