Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T42521
|
|||||
| Target Name |
Bacterial Shiga toxin 2 subunit B (Bact stxII)
|
|||||
| Synonyms |
Stx2B protein; Stx2B; Stx2 holotoxin subunit B; Stx2 holotoxin B subunit; Shiga-like toxin type II B subunit; Shiga toxin subunit B; Shiga toxin 2v subunit A; Shiga toxin 2B; Shiga toxin 2, subunit B; Shiga toxin 2 B subunit
Click to Show/Hide
|
|||||
| Gene Name |
Bact stxII
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Bacterial infection [ICD-11: 1A00-1C4Z] | |||||
| Function |
Shiga toxin, one of the most potent bacterial toxins known. Binds to the cellular receptor, globotriaosylceramide, Gb3, found primarily on endothelial cells.
Click to Show/Hide
|
|||||
| UniProt ID | ||||||
| Sequence |
MKKMFMAVLFALVSVNAMAADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQS
AQLTGMTVTIKSSTCESGSGFAEVQFNND Click to Show/Hide
|
|||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 1 Clinical Trial Drugs | + | ||||
| 1 | Shigamabs | Drug Info | Phase 3 | Bacterial infection | [2] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| Modulator | [+] 1 Modulator drugs | + | ||||
| 1 | Shigamabs | Drug Info | [1] | |||
| Drug Binding Sites of Target | Top | |||||
|---|---|---|---|---|---|---|
| Ligand Name: 3-(Pyridin-1-ium-1-yl)propane-1-sulfonate | Ligand Info | |||||
| Structure Description | The crystal structure of Stx2 and a disaccharide ligand | PDB:4M1U | ||||
| Method | X-ray diffraction | Resolution | 1.56 Å | Mutation | No | [3] |
| PDB Sequence |
ADCAKGKIEF
10 SKYNEDDTFT20 VKVDGKEYWT30 SRWNLQPLLQ40 SAQLTGMTVT50 IKSSTCESGS 60 GFAEVQFNND70
|
|||||
|
|
||||||
| Click to View More Binding Site Information of This Target and Ligand Pair | ||||||
| Click to View More Binding Site Information of This Target with Different Ligands | ||||||
| Different Human System Profiles of Target | Top |
|---|---|
|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
|
|
There is no similarity protein (E value < 0.005) for this target
|
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Antibacterial antibodies gain traction. Nat Rev Drug Discov. 2015 Nov;14(11):737-8. | |||||
| REF 2 | Clinical pipeline report, company report or official report of BELLUS Health Inc. | |||||
| REF 3 | The crystal structure of shiga toxin type 2 with bound disaccharide guides the design of a heterobifunctional toxin inhibitor. J Biol Chem. 2014 Jan 10;289(2):885-94. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.