Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T39977
(Former ID: TTDC00103)
|
|||||
| Target Name |
Macrophage migration inhibitory factor (MIF)
|
|||||
| Synonyms |
Phenylpyruvate tautomerase; MMIF; L-dopachrome tautomerase; L-dopachrome isomerase; Glycosylation-inhibiting factor; GLIF; GIF
|
|||||
| Gene Name |
MIF
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Thrombocytopenia [ICD-11: 3B64] | |||||
| Function |
Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity. Pro-inflammatory cytokine.
Click to Show/Hide
|
|||||
| BioChemical Class |
Intramolecular oxidoreductase
|
|||||
| UniProt ID | ||||||
| EC Number |
EC 5.3.2.1
|
|||||
| Sequence |
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALC
SLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | PDB | ||||
| ADReCS ID | BADD_A05088 ; BADD_A08298 | |||||
| HIT2.0 ID | T89GFN | |||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Approved Drug(s) | [+] 2 Approved Drugs | + | ||||
| 1 | 3,4-Dihydroxycinnamic Acid | Drug Info | Phase 4 | Thrombocytopenia | [2] | |
| 2 | Anti-MIF antibodies | Drug Info | Phase 4 | Autoimmune diabetes | [3] | |
| Preclinical Drug(s) | [+] 1 Preclinical Drugs | + | ||||
| 1 | COR100140 | Drug Info | Preclinical | Inflammation | [4] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| Inhibitor | [+] 10 Inhibitor drugs | + | ||||
| 1 | 3,4-Dihydroxycinnamic Acid | Drug Info | [5] | |||
| 2 | Anti-MIF antibodies | Drug Info | [1] | |||
| 3 | ISO-1 | Drug Info | [6] | |||
| 4 | COR100140 | Drug Info | [7] | |||
| 5 | 4-HYDROXYBENZALDEHYDE O-(CYCLOHEXYLCARBONYL)OXIME | Drug Info | [8] | |||
| 6 | 4-hydroxyphenylpyruvic acid | Drug Info | [8] | |||
| 7 | 6-HYDROXY-1,3-BENZOTHIAZOLE-2-SULFONAMIDE | Drug Info | [8] | |||
| 8 | AVP-13546 | Drug Info | [9] | |||
| 9 | AVP-13748 | Drug Info | [9] | |||
| 10 | NAPQI | Drug Info | [9] | |||
| Chemical Structure based Activity Landscape of Target | Top |
|---|---|
| Drug Property Profile of Target | Top | |
|---|---|---|
| (1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
|
||
| (3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
|
||
| (5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
|
||
| "RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five | ||
| Target Poor or Non Binders | Top | |||||
|---|---|---|---|---|---|---|
| Target Poor or Non Binders | ||||||
| Target Regulators | Top | |||||
|---|---|---|---|---|---|---|
| Target-regulating microRNAs | ||||||
| Target-interacting Proteins | ||||||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| KEGG Pathway | [+] 2 KEGG Pathways | + | ||||
| 1 | Tyrosine metabolism | |||||
| 2 | Phenylalanine metabolism | |||||
| Pathwhiz Pathway | [+] 1 Pathwhiz Pathways | + | ||||
| 1 | Tyrosine Metabolism | |||||
| WikiPathways | [+] 2 WikiPathways | + | ||||
| 1 | Spinal Cord Injury | |||||
| 2 | Adipogenesis | |||||
| Target-Related Models and Studies | Top | |||||
|---|---|---|---|---|---|---|
| Target Validation | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Neutralization of Macrophage Migration Inhibitory Factor (MIF) by Fully Human Antibodies Correlates with Their Specificity for the beta-Sheet Structure of MIF. J Biol Chem. 2012 March 2; 287(10): 7446-7455. | |||||
| REF 2 | ClinicalTrials.gov (NCT02556814) Caffeic Acid Combining High-dose Dexamethasone in Management of ITP. U.S. National Institutes of Health. | |||||
| REF 3 | ClinicalTrials.gov (NCT01452997) Evaluation of Anti-inflammatories in the Reduction of Bite Reactions. U.S. National Institutes of Health. | |||||
| REF 4 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800020117) | |||||
| REF 5 | How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | |||||
| REF 6 | The tautomerase active site of macrophage migration inhibitory factor is a potential target for discovery of novel anti-inflammatory agents. J Biol Chem. 2002 Jul 12;277(28):24976-82. | |||||
| REF 7 | Cortical Pty Ltd Presents MIF Antagonist Data at World Congress on Inflammation. Cortical Pty Ltd. 2005. | |||||
| REF 8 | The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. | |||||
| REF 9 | MIF in autoimmunity and novel therapeutic approaches. Autoimmun Rev. 2009 Jan;8(3):244-9. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.