Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T35734
(Former ID: TTDR01203)
|
|||||
Target Name |
Soluble epoxide hydrolase (EPHX2)
|
|||||
Synonyms |
Bifunctional epoxide hydrolase 2
|
|||||
Gene Name |
EPHX2
|
|||||
Target Type |
Clinical trial target
|
[1] | ||||
Disease | [+] 2 Target-related Diseases | + | ||||
1 | Hypertension [ICD-11: BA00-BA04] | |||||
2 | Chronic obstructive pulmonary disease [ICD-11: CA22] | |||||
Function |
Bifunctional enzyme. The C-terminal domain has epoxide hydrolase activity and acts on epoxides (alkene oxides, oxiranes) and arene oxides. Plays a role in xenobiotic metabolism by degrading potentially toxic epoxides (By similarity). Also determines steady-state levels of physiological mediators. The N-terminal domain has lipid phosphatase activity, with the highest activity towards threo-9,10-phosphonooxy-hydroxy-octadecanoic acid, followed by erythro-9,10-phosphonooxy-hydroxy-octadecanoic acid, 12-phosphonooxy-octadec-9Z-enoic acid and 12-phosphonooxy-octadec-9E-enoic acid.
Click to Show/Hide
|
|||||
BioChemical Class |
Ether bond hydrolase
|
|||||
UniProt ID | ||||||
Sequence |
MTLRAAVFDLDGVLALPAVFGVLGRTEEALALPRGLLNDAFQKGGPEGATTRLMKGEITL
SQWIPLMEENCRKCSETAKVCLPKNFSIKEIFDKAISARKINRPMLQAALMLRKKGFTTA ILTNTWLDDRAERDGLAQLMCELKMHFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEV VFLDDIGANLKPARDLGMVTILVQDTDTALKELEKVTGIQLLNTPAPLPTSCNPSDMSHG YVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESS APPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNT PFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMH KVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSL GRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIK WLDSDARNPPVVSKM Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | PDB | ||||
ADReCS ID | BADD_A01328 ; BADD_A04278 | |||||
HIT2.0 ID | T63YQM |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 2 Clinical Trial Drugs | + | ||||
1 | AR9281 | Drug Info | Phase 2 | Hypertension | [2] | |
2 | GSK2256294 | Drug Info | Phase 1 | Chronic obstructive pulmonary disease | [3] | |
Mode of Action | [+] 2 Modes of Action | + | ||||
Inhibitor | [+] 105 Inhibitor drugs | + | ||||
1 | AR9281 | Drug Info | [1] | |||
2 | 1,3-DIPHENYLUREA | Drug Info | [5] | |||
3 | 1-(1-Adamantyl)-3-(1-propionylpiperidin-4-yl)urea | Drug Info | [6] | |||
4 | 1-(1-Propionylpiperidin-4-yl)-3-m-tolylurea | Drug Info | [6] | |||
5 | 1-(1-Propionylpiperidin-4-yl)-3-o-tolylurea | Drug Info | [6] | |||
6 | 1-(1-Propionylpiperidin-4-yl)-3-p-tolylurea | Drug Info | [6] | |||
7 | 1-(3-(3-morpholinopropoxy)phenyl)-3-phenylurea | Drug Info | [7] | |||
8 | 1-(3-Chloro-phenyl)-3-(4-hydroxy-decyl)-urea | Drug Info | [8] | |||
9 | 1-(3-Chloro-phenyl)-3-cyclohexyl-urea | Drug Info | [8] | |||
10 | 1-(4-(3-morpholinopropoxy)phenyl)-3-phenylurea | Drug Info | [7] | |||
11 | 1-adamantan-1-yl-3-((R)-1-phenyl-ethyl)-urea | Drug Info | [9] | |||
12 | 1-adamantan-1-yl-3-(1-benzyl-piperidin-4-yl)-urea | Drug Info | [10] | |||
13 | 1-adamantan-1-yl-3-(1-butyl-piperidin-4-yl)-urea | Drug Info | [10] | |||
14 | 1-adamantan-1-yl-3-(1-ethyl-piperidin-4-yl)-urea | Drug Info | [10] | |||
15 | 1-adamantan-1-yl-3-(1-propyl-piperidin-4-yl)-urea | Drug Info | [10] | |||
16 | 1-adamantan-1-yl-3-(2-heptyloxyethyl)urea | Drug Info | [11] | |||
17 | 1-Adamantan-1-yl-3-(2-hydroxy-phenyl)-urea | Drug Info | [12] | |||
18 | 1-adamantan-1-yl-3-(2-hydroxyethyl)urea | Drug Info | [11] | |||
19 | 1-Adamantan-1-yl-3-(2-methoxy-phenyl)-urea | Drug Info | [12] | |||
20 | 1-adamantan-1-yl-3-(3-hexyloxypropyl)urea | Drug Info | [11] | |||
21 | 1-Adamantan-1-yl-3-(3-hydroxy-phenyl)-urea | Drug Info | [12] | |||
22 | 1-adamantan-1-yl-3-(3-hydroxypropyl)urea | Drug Info | [11] | |||
23 | 1-Adamantan-1-yl-3-(3-methoxy-phenyl)-urea | Drug Info | [12] | |||
24 | 1-Adamantan-1-yl-3-(4-hydroxy-decyl)-urea | Drug Info | [8] | |||
25 | 1-Adamantan-1-yl-3-(4-hydroxy-phenyl)-urea | Drug Info | [12] | |||
26 | 1-adamantan-1-yl-3-(4-hydroxybutyl)urea | Drug Info | [11] | |||
27 | 1-Adamantan-1-yl-3-(4-methoxy-phenyl)-urea | Drug Info | [12] | |||
28 | 1-adamantan-1-yl-3-(4-pentyloxybutyl)urea | Drug Info | [11] | |||
29 | 1-adamantan-1-yl-3-(4-pentyloxycylclohexyl)urea | Drug Info | [11] | |||
30 | 1-adamantan-1-yl-3-(5-butoxypentyl)urea | Drug Info | [11] | |||
31 | 1-adamantan-1-yl-3-(5-hydroxypentyl)urea | Drug Info | [11] | |||
32 | 1-adamantan-1-yl-3-(6-hydroxyhexyl)urea | Drug Info | [11] | |||
33 | 1-adamantan-1-yl-3-(6-propyloxyhexyl)urea | Drug Info | [11] | |||
34 | 1-Adamantan-1-yl-3-decyl-urea | Drug Info | [8] | |||
35 | 1-Adamantan-1-yl-3-phenyl-urea | Drug Info | [12] | |||
36 | 1-adamantan-1-yl-3-piperidin-4-yl-urea | Drug Info | [10] | |||
37 | 1-adamantan-1-yl-3-piperidin-4-ylmethyl-urea | Drug Info | [10] | |||
38 | 1-adamantan-1-yl-3-[4-(4-fluorophenoxy)butyl]urea | Drug Info | [1] | |||
39 | 1-Cycloheptyl-3-(1-propionylpiperidin-4-yl)urea | Drug Info | [6] | |||
40 | 1-Cyclohexyl-3-(1-propionylpiperidin-4-yl)urea | Drug Info | [6] | |||
41 | 1-Cyclohexyl-3-(4-methoxy-phenyl)-urea | Drug Info | [8] | |||
42 | 1-Cyclohexyl-3-phenethyl-urea | Drug Info | [8] | |||
43 | 1-Cyclohexyl-3-phenyl-urea | Drug Info | [8] | |||
44 | 1-Octyl-3-(1-propionylpiperidin-4-yl)urea | Drug Info | [6] | |||
45 | 1-Phenyl-3-(1-propionylpiperidin-4-yl)urea | Drug Info | [6] | |||
46 | 12-(3-Adamantan-1-yl-ureido)-dodeca noic acid | Drug Info | [13] | |||
47 | 12-(3-n-Hexylureido)dodec-8(Z)-enoic acid | Drug Info | [14] | |||
48 | 12-(3-n-Pentylureidooxy)dodec-8(Z)-enoic acid | Drug Info | [14] | |||
49 | 13-(3-n-Pentylthioureido)tridec-8(Z)-enoic Acid | Drug Info | [14] | |||
50 | 13-(3-n-Pentylureido)tridec-5(Z)-enoic acid | Drug Info | [14] | |||
51 | 13-(3-n-Pentylureido)tridec-8(E)-enoic acid | Drug Info | [14] | |||
52 | 13-(3-n-Pentylureido)tridec-8-ynoic acid | Drug Info | [14] | |||
53 | 13-(3-Pentyluredo)tridec-8(Z)-enoic acid | Drug Info | [14] | |||
54 | 13-(5-n-Pentylfuran-2-yl)tridec-8(Z)-enoic acid | Drug Info | [14] | |||
55 | 13-(N-Isopropylheptanamido)tridec-8(Z)-enoic acid | Drug Info | [14] | |||
56 | 13-(N-Methyl-n-heptnamido)tridec-8(Z)-enoic acid | Drug Info | [14] | |||
57 | 13-(n-Pentylcarbamoyloxy)tridec-8(Z)-enoic acid | Drug Info | [14] | |||
58 | 13-n-Heptanamidotridec-5-ynoic acid | Drug Info | [14] | |||
59 | 13-n-Heptanamidotridec-8(Z)-enoic acid | Drug Info | [14] | |||
60 | 14-(n-Hexylamino)-14-oxotetradec-8(Z)-enoic acid | Drug Info | [14] | |||
61 | 16-(3-Ethylureido)hexadec-11(Z)-enoic acid | Drug Info | [14] | |||
62 | 2-Adamantan-1-yl-N-decyl-acetamide | Drug Info | [8] | |||
63 | 2-Cyclohexyl-N-(4-methoxy-phenyl)-acetamide | Drug Info | [8] | |||
64 | 2-Cyclohexyl-N-phenethyl-acetamide | Drug Info | [8] | |||
65 | 2-Cyclohexyl-N-phenyl-acetamide | Drug Info | [8] | |||
66 | 3-(3-Adamantan-1-yl-ureido)-benzoic acid | Drug Info | [12] | |||
67 | 4,4-Diphenyl-N-(pyridin-3-yl)-butyramide | Drug Info | [15] | |||
68 | 4-(3-Adamantan-1-yl-ureido)-benzoic acid | Drug Info | [12] | |||
69 | 4-(3-cyclohexylureido)butanoic acid | Drug Info | [5], [16] | |||
70 | 6-amino-N-(2,4-dichlorobenzyl)nicotinamide | Drug Info | [17] | |||
71 | 6-amino-N-(3,3-diphenylpropyl)nicotinamide | Drug Info | [17] | |||
72 | 6-{[(CYCLOHEXYLAMINO)CARBONYL]AMINO}HEXANOIC ACID | Drug Info | [5] | |||
73 | 9-(3-n-Pentylureido)non-4(Z)-enoic acid | Drug Info | [14] | |||
74 | 9-(3-n-Pentylureido)non-4-ynoic acid | Drug Info | [14] | |||
75 | Cis-1-adamantan-1-yl-3-(4-hydroxycyclohexyl)urea | Drug Info | [1] | |||
76 | Cis-1-adamantan-1-yl-3-(4-methoxycyclohexyl)urea | Drug Info | [1] | |||
77 | Dodecanoic acid adamantan-1-ylamide | Drug Info | [8] | |||
78 | EXRD-4605 | Drug Info | [3] | |||
79 | Methyl 14-(3-n-butylureido)tetradec-8(Z)-enoate | Drug Info | [14] | |||
80 | Methyl 4-(3-cyclohexylureido)butanoate | Drug Info | [16] | |||
81 | Methyl 6-(3-cyclohexylureido)hexanoate | Drug Info | [16] | |||
82 | N,N'-dicyclohexyl-urea | Drug Info | [1] | |||
83 | N-(3,3-Diphenyl-propyl)-2-pyridine-3-ylacetamide | Drug Info | [15] | |||
84 | N-(3,3-Diphenyl-propyl)-isonicotinamide | Drug Info | [15] | |||
85 | N-(3,3-diphenyl-propyl)-nicotinamide | Drug Info | [15] | |||
86 | N-(3-Chloro-phenyl)-2-cyclohexyl-acetamide | Drug Info | [8] | |||
87 | N-(3-Phenyl-propyl)-nicotinamide | Drug Info | [15] | |||
88 | N-(4,4-Diphenyl-butyl)-nicotinamide | Drug Info | [15] | |||
89 | N-(biphenyl-3-yl)benzo[d]isoxazol-3-amine | Drug Info | [18] | |||
90 | N-(biphenyl-4-yl)benzo[d]isoxazol-3-amine | Drug Info | [18] | |||
91 | N-(naphthalen-1-yl)benzo[d]isoxazol-3-amine | Drug Info | [18] | |||
92 | N-(naphthalen-2-yl)benzo[d]isoxazol-3-amine | Drug Info | [18] | |||
93 | N-adamantyl-N'-cyclohexylurea | Drug Info | [1] | |||
94 | N-benzyl-6-(3,3,3-trifluoropropoxy)nicotinamide | Drug Info | [17] | |||
95 | N-Cyclohexyl-2-(4-methoxy-phenyl)-acetamide | Drug Info | [8] | |||
96 | N-Cyclohexyl-2-phenyl-acetamide | Drug Info | [8] | |||
97 | N-Cyclohexyl-4-phenyl-butyramide | Drug Info | [8] | |||
98 | N-Cyclohexyl-N'-(4-Iodophenyl)Urea | Drug Info | [19] | |||
99 | N-Cyclohexyl-N'-(Propyl)Phenyl Urea | Drug Info | [5] | |||
100 | N-Cyclohexyl-N'-Decylurea | Drug Info | [5] | |||
101 | N-[(CYCLOHEXYLAMINO)CARBONYL]GLYCINE | Drug Info | [5] | |||
102 | N-[3,3-Bis-(4-fluorophenyl)-propyl]-benzamide | Drug Info | [15] | |||
103 | N-[3,3-Bis-(4-fluorophenyl)-propyl]-nicotinamide | Drug Info | [15] | |||
104 | Trans,trans-1,3-bis-(4-hydroxycyclohexyl)urea | Drug Info | [1] | |||
105 | [4-(3-Adamantan-1-yl-ureido)-phenyl]-acetic acid | Drug Info | [12] | |||
Modulator | [+] 1 Modulator drugs | + | ||||
1 | GSK2256294 | Drug Info | [3], [4] |
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Co-Targets | Top | |||||
---|---|---|---|---|---|---|
Co-Targets |
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-interacting Proteins |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 3 KEGG Pathways | + | ||||
1 | Arachidonic acid metabolism | |||||
2 | Metabolic pathways | |||||
3 | Peroxisome | |||||
Pathwhiz Pathway | [+] 1 Pathwhiz Pathways | + | ||||
1 | Arachidonic Acid Metabolism | |||||
WikiPathways | [+] 3 WikiPathways | + | ||||
1 | Metapathway biotransformation | |||||
2 | Arachidonate Epoxygenase / Epoxide Hydrolase | |||||
3 | Arachidonic acid metabolism |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Orally bioavailable potent soluble epoxide hydrolase inhibitors. J Med Chem. 2007 Aug 9;50(16):3825-40. | |||||
REF 2 | ClinicalTrials.gov (NCT00847899) Evaluation of Soluble Epoxide Hydrolase (s-EH) Inhibitor in Patients With Mild to Moderate Hypertension and Impaired Glucose Tolerance. U.S. National Institutes of Health. | |||||
REF 3 | Soluble epoxide hydrolase inhibition does not prevent cardiac remodeling and dysfunction after aortic constriction in rats and mice. J Cardiovasc Pharmacol. 2013 Apr;61(4):291-301. | |||||
REF 4 | In vitro and in vivo characterization of a novel soluble epoxide hydrolase inhibitor. Prostaglandins Other Lipid Mediat. 2013 Jul-Aug;104-105:25-31. | |||||
REF 5 | The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. | |||||
REF 6 | 1-Aryl-3-(1-acylpiperidin-4-yl)urea inhibitors of human and murine soluble epoxide hydrolase: structure-activity relationships, pharmacokinetics, a... J Med Chem. 2010 Oct 14;53(19):7067-75. | |||||
REF 7 | Unsymmetrical non-adamantyl N,N'-diaryl urea and amide inhibitors of soluble expoxide hydrolase. Bioorg Med Chem Lett. 2009 Aug 1;19(15):4259-63. | |||||
REF 8 | Optimization of amide-based inhibitors of soluble epoxide hydrolase with improved water solubility. J Med Chem. 2005 May 19;48(10):3621-9. | |||||
REF 9 | Solid-phase combinatorial approach for the optimization of soluble epoxide hydrolase inhibitors. Bioorg Med Chem Lett. 2006 Nov 15;16(22):5773-7. | |||||
REF 10 | Synthesis and SAR of conformationally restricted inhibitors of soluble epoxide hydrolase. Bioorg Med Chem Lett. 2006 Oct 1;16(19):5212-6. | |||||
REF 11 | 1,3-disubstituted ureas functionalized with ether groups are potent inhibitors of the soluble epoxide hydrolase with improved pharmacokinetic prope... J Med Chem. 2007 Oct 18;50(21):5217-26. | |||||
REF 12 | Salicylate-urea-based soluble epoxide hydrolase inhibitors with high metabolic and chemical stabilities. Bioorg Med Chem Lett. 2009 Mar 15;19(6):1784-9. | |||||
REF 13 | Discovery of a highly potent, selective, and bioavailable soluble epoxide hydrolase inhibitor with excellent ex vivo target engagement. J Med Chem. 2009 Aug 27;52(16):5009-12. | |||||
REF 14 | 14,15-Epoxyeicosa-5,8,11-trienoic acid (14,15-EET) surrogates containing epoxide bioisosteres: influence upon vascular relaxation and soluble epoxi... J Med Chem. 2009 Aug 27;52(16):5069-75. | |||||
REF 15 | Structure-based optimization of arylamides as inhibitors of soluble epoxide hydrolase. J Med Chem. 2009 Oct 8;52(19):5880-95. | |||||
REF 16 | Peptidyl-urea based inhibitors of soluble epoxide hydrolases. Bioorg Med Chem Lett. 2006 Oct 15;16(20):5439-44. | |||||
REF 17 | Design and synthesis of substituted nicotinamides as inhibitors of soluble epoxide hydrolase. Bioorg Med Chem Lett. 2009 Oct 15;19(20):5864-8. | |||||
REF 18 | A strategy of employing aminoheterocycles as amide mimics to identify novel, potent and bioavailable soluble epoxide hydrolase inhibitors. Bioorg Med Chem Lett. 2009 Oct 1;19(19):5716-21. | |||||
REF 19 | How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.