Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T32578
(Former ID: TTDC00080)
|
|||||
| Target Name |
Interleukin-6 (IL6)
|
|||||
| Synonyms |
Interferon beta-2; IL-6; IFNB2; IFN-beta-2; Hybridoma growth factor; CTL differentiation factor; CDF; BSF-2; B-cell stimulatory factor 2
|
|||||
| Gene Name |
IL6
|
|||||
| Target Type |
Successful target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Anemia [ICD-11: 3A00-3A9Z] | |||||
| Function |
It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. Acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. Required for the generation of T(H)17 cells. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation. Cytokine with a wide variety of biological functions.
Click to Show/Hide
|
|||||
| BioChemical Class |
Cytokine: interleukin
|
|||||
| UniProt ID | ||||||
| Sequence |
MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI
LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | PDB | ||||
| ADReCS ID | BADD_A03633 ; BADD_A04013 ; BADD_A05078 ; BADD_A05675 ; BADD_A05823 ; BADD_A05962 ; BADD_A06761 | |||||
| HIT2.0 ID | T33OPP | |||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Approved Drug(s) | [+] 1 Approved Drugs | + | ||||
| 1 | Siltuximab | Drug Info | Approved | Anemia | [1], [2], [3] | |
| Clinical Trial Drug(s) | [+] 11 Clinical Trial Drugs | + | ||||
| 1 | Olokizumab | Drug Info | Phase 3 | Rheumatoid arthritis | [4] | |
| 2 | Sirukumab | Drug Info | Phase 3 | Rheumatoid arthritis | [5], [6] | |
| 3 | ALD-518 | Drug Info | Phase 2 | Rheumatoid arthritis | [7] | |
| 4 | CDP-6038 | Drug Info | Phase 2 | Rheumatoid arthritis | [7] | |
| 5 | Clazakizumab | Drug Info | Phase 2 | Crohn disease | [8] | |
| 6 | PF-04236921 | Drug Info | Phase 2 | Systemic lupus erythematosus | [9] | |
| 7 | YSIL6 | Drug Info | Phase 2 | Crohn disease | [10] | |
| 8 | C326 | Drug Info | Phase 1 | Crohn disease | [11] | |
| 9 | Gerilimzumab | Drug Info | Phase 1 | Rheumatoid arthritis | [4] | |
| 10 | MEDI5117 | Drug Info | Phase 1 | Rheumatoid arthritis | [12] | |
| 11 | OP-R003 | Drug Info | Phase 1 | Haematological malignancy | [13] | |
| Mode of Action | [+] 2 Modes of Action | + | ||||
| Modulator | [+] 5 Modulator drugs | + | ||||
| 1 | Olokizumab | Drug Info | [14] | |||
| 2 | ALD-518 | Drug Info | [7] | |||
| 3 | CDP-6038 | Drug Info | [7] | |||
| 4 | MEDI5117 | Drug Info | [18] | |||
| 5 | OP-R003 | Drug Info | [19] | |||
| Inhibitor | [+] 5 Inhibitor drugs | + | ||||
| 1 | Sirukumab | Drug Info | [4], [15] | |||
| 2 | Clazakizumab | Drug Info | [4] | |||
| 3 | PF-04236921 | Drug Info | [4] | |||
| 4 | YSIL6 | Drug Info | [16] | |||
| 5 | C326 | Drug Info | [17] | |||
| Chemical Structure based Activity Landscape of Target | Top |
|---|---|
| Co-Targets | Top | |||||
|---|---|---|---|---|---|---|
| Co-Targets | ||||||
| Target Regulators | Top | |||||
|---|---|---|---|---|---|---|
| Target-regulating microRNAs | ||||||
| Target Profiles in Patients | Top | |||||
|---|---|---|---|---|---|---|
| Target Expression Profile (TEP) | ||||||
| Target-Related Models and Studies | Top | |||||
|---|---|---|---|---|---|---|
| Target Validation | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | 2014 FDA drug approvals. Nat Rev Drug Discov. 2015 Feb;14(2):77-81. | |||||
| REF 2 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7396). | |||||
| REF 3 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
| REF 4 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 5 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7989). | |||||
| REF 6 | ClinicalTrials.gov (NCT02531633) Efficacy and Safety Study of Sirukumab in Patients With Giant Cell Arteritis. | |||||
| REF 7 | Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41. | |||||
| REF 8 | ClinicalTrials.gov (NCT02015520) Phase IIB Dose Ranging Study in Subjects With Moderate to Severe Rheumatoid Arthritis. U.S. National Institutes of Health. | |||||
| REF 9 | ClinicalTrials.gov (NCT01405196) Subcutaneous Treatment In Randomized Subjects To Evaluate Safety And Efficacy In Generalized Lupus Erythematosus. U.S. National Institutes of Health. | |||||
| REF 10 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800020380) | |||||
| REF 11 | ClinicalTrials.gov (NCT00353756) Phase 1 Study of Safety and Biological Effects of C326, an Inhibitor of IL-6, in Crohn's Disease. U.S. National Institutes of Health. | |||||
| REF 12 | ClinicalTrials.gov (NCT01559103) Study to Assess the Safety and Tolerability of MEDI5117 in Rheumatoid Arthritis Patients. U.S. National Institutes of Health. | |||||
| REF 13 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800034097) | |||||
| REF 14 | Efficacy and safety of olokizumab in patients with rheumatoid arthritis with an inadequate response to TNF inhibitor therapy: outcomes of a randomised Phase IIb study. Ann Rheum Dis. 2014 September; 73(9): 1607-1615. | |||||
| REF 15 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 16 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800020380) | |||||
| REF 17 | The molecular basis of hepcidin-resistant hereditary hemochromatosis. Blood. 2009 Jul 9;114(2):437-43. | |||||
| REF 18 | Whole-molecule antibody engineering: generation of a high-affinity anti-IL-6 antibody with extended pharmacokinetics. J Mol Biol. 2011 Aug 26;411(4):791-807. | |||||
| REF 19 | A high-affinity fully human anti-IL-6 mAb (OP-R003-1, 1339) for the treatment of Multiple Myeloma | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.