Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T24626
|
|||||
| Target Name |
Haemophilus influenzae Acetylglucosamine deacetylase (Hae-influ lpxC)
|
|||||
| Synonyms |
UDP-3-O-acyl-N-acetylglucosamine deacetylase; UDP-3-O-[R-3-hydroxymyristoyl]-N-acetylglucosamine deacetylase; Hae-influ UDP-3-O-acyl-GlcNAc deacetylase
Click to Show/Hide
|
|||||
| Gene Name |
Hae-influ lpxC
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Glanders [ICD-11: 1B92] | |||||
| Function |
Catalyzes the hydrolysis of UDP-3-O-myristoyl-N-acetylglucosamine to form UDP-3-O-myristoylglucosamine and acetate, the committed step in lipid A biosynthesis.
Click to Show/Hide
|
|||||
| UniProt ID | ||||||
| EC Number |
EC 3.5.1.108
|
|||||
| Sequence |
MIKQRTLKQSIKVTGVGLHSGNKVTLTLRPAMPNTGVVYYRTDLNPAVAFPADPNSVRDT
MLCTALINDQGVRISTVEHLNAALAGLGIDNIIIEVDAPEIPIMDGSASPFIYLLLDAGI EEQNAAKKFIRIKEYVRVEDGDKWAEFKPYNGFRLDFTIDFDHPAIGKDVRNYEMNFSAQ AFVHQISRARTFGFMKDIEYLQSQGLALGGSLDNAIVLDDYRILNEDGLRFKDELVRHKM LDAIGDLYMAGYNIIGDFKAYKSGHGLNNKLLRAVLANQEAWEFVTFEDKEQVPQGYVAP AQVLI Click to Show/Hide
|
|||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 1 Clinical Trial Drugs | + | ||||
| 1 | ACHN-975 | Drug Info | Phase 1 | Pseudomonas infection | [2] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| Modulator | [+] 1 Modulator drugs | + | ||||
| 1 | ACHN-975 | Drug Info | [1] | |||
| Different Human System Profiles of Target | Top |
|---|---|
|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
|
|
There is no similarity protein (E value < 0.005) for this target
|
| Co-Targets | Top | |||||
|---|---|---|---|---|---|---|
| Co-Targets | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41. | |||||
| REF 2 | ClinicalTrials.gov (NCT01870245) A Multiple Dose Study to Assess the Safety, Tolerability, and Pharmacokinetics of ACHN-975 in Healthy Volunteers. U.S. National Institutes of Health. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.