Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T18551
|
|||||
| Target Name |
CD80-PD-L1 interaction (CD80/PD-L1 PPI)
|
|||||
| Synonyms |
T-lymphocyte activation antigen CD80/Programmed cell death 1 ligand 1 PPI
Click to Show/Hide
|
|||||
| Gene Name |
CD80-CD274
|
|||||
| Target Type |
Patented-recorded target
|
[1] | ||||
| Disease | [+] 4 Target-related Diseases | + | ||||
| 1 | Human immunodeficiency virus disease [ICD-11: 1C60-1C62] | |||||
| 2 | Inflammatory liver disease [ICD-11: DB97] | |||||
| 3 | Postoperative inflammation [ICD-11: 1A00-CA43] | |||||
| 4 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||||
| Function |
Augments activated alloreactive CD4+ T cell proliferation and apoptosis and ameliorates acute graft versus host disease
Click to Show/Hide
|
|||||
| UniProt ID | ||||||
| Sequence |
MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEME
DKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGG ADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTT TTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTH LVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEETMGHTRRQGTS PSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEK KMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREH LAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVS QDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNLLPSWAIT LISVNGIFVICCLTYCFAPRCRERRRNERLRRESVRPV Click to Show/Hide
|
|||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Patented Agent(s) | [+] 13 Patented Agents | + | ||||
| 1 | Biaryl compound 1 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 2 | Biaryl compound 2 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 3 | Macrocycle derivative 1 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 4 | Macrocycle derivative 2 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 5 | Macrocycle derivative 3 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 6 | Macrocycle derivative 4 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 7 | Macrocycle derivative 5 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 8 | Macrocycle derivative 6 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 9 | Macrocycle derivative 7 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 10 | Macrocycle derivative 8 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 11 | Macrocycle derivative 9 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 12 | PMID30107136-Compound-Example11 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| 13 | PMID30107136-Compound-Example12 | Drug Info | Patented | Solid tumour/cancer | [1] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| Inhibitor | [+] 13 Inhibitor drugs | + | ||||
| 1 | Biaryl compound 1 | Drug Info | [1] | |||
| 2 | Biaryl compound 2 | Drug Info | [1] | |||
| 3 | Macrocycle derivative 1 | Drug Info | [1] | |||
| 4 | Macrocycle derivative 2 | Drug Info | [1] | |||
| 5 | Macrocycle derivative 3 | Drug Info | [1] | |||
| 6 | Macrocycle derivative 4 | Drug Info | [1] | |||
| 7 | Macrocycle derivative 5 | Drug Info | [1] | |||
| 8 | Macrocycle derivative 6 | Drug Info | [1] | |||
| 9 | Macrocycle derivative 7 | Drug Info | [1] | |||
| 10 | Macrocycle derivative 8 | Drug Info | [1] | |||
| 11 | Macrocycle derivative 9 | Drug Info | [1] | |||
| 12 | PMID30107136-Compound-Example11 | Drug Info | [1] | |||
| 13 | PMID30107136-Compound-Example12 | Drug Info | [1] | |||
| Drug Property Profile of Target | Top | |
|---|---|---|
| (1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
|
||
| (3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
|
||
| (5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
|
||
| "RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five | ||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | A patent review on PD-1/PD-L1 antagonists: small molecules, peptides, and macrocycles (2015-2018).Expert Opin Ther Pat. 2018 Sep;28(9):665-678. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.