Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T16117
(Former ID: TTDC00063)
|
|||||
| Target Name |
Nitric-oxide synthase brain (NOS1)
|
|||||
| Synonyms |
Peptidyl-cysteine S-nitrosylase NOS1; Nitric oxide synthase, brain; Neuronal NOS; NOS, type I; NOS type I; NNOS; NC-NOS; N-NOS; BNOS
|
|||||
| Gene Name |
NOS1
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 2 Target-related Diseases | + | ||||
| 1 | Headache [ICD-11: 8A80-8A84] | |||||
| 2 | Migraine [ICD-11: 8A80] | |||||
| Function |
In the brain and peripheral nervous system, NO displays many properties of a neurotransmitter. Probably has nitrosylase activity and mediates cysteine S-nitrosylation of cytoplasmic target proteins such SRR. Produces nitric oxide (NO) which is a messenger molecule with diverse functions throughout the body.
Click to Show/Hide
|
|||||
| BioChemical Class |
Paired donor oxygen oxidoreductase
|
|||||
| UniProt ID | ||||||
| EC Number |
EC 1.14.13.39
|
|||||
| Sequence |
MEDHMFGVQQIQPNVISVRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQA
GDIILAVNGRPLVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTI RVTQPLGPPTKAVDLSHQPPAGKEQPLAVDGASGPGNGPQHAYDDGQEAGSLPHANGLAP RPPGQDPAKKATRVSLQGRGENNELLKEIEPVLSLLTSGSRGVKGGAPAKAEMKDMGIQV DRDLDGKSHKPLPLGVENDRVFNDLWGKGNVPVVLNNPYSEKEQPPTSGKQSPTKNGSPS KCPRFLKVKNWETEVVLTDTLHLKSTLETGCTEYICMGSIMHPSQHARRPEDVRTKGQLF PLAKEFIDQYYSSIKRFGSKAHMERLEEVNKEIDTTSTYQLKDTELIYGAKHAWRNASRC VGRIQWSKLQVFDARDCTTAHGMFNYICNHVKYATNKGNLRSAITIFPQRTDGKHDFRVW NSQLIRYAGYKQPDGSTLGDPANVQFTEICIQQGWKPPRGRFDVLPLLLQANGNDPELFQ IPPELVLEVPIRHPKFEWFKDLGLKWYGLPAVSNMLLEIGGLEFSACPFSGWYMGTEIGV RDYCDNSRYNILEEVAKKMNLDMRKTSSLWKDQALVEINIAVLYSFQSDKVTIVDHHSAT ESFIKHMENEYRCRGGCPADWVWIVPPMSGSITPVFHQEMLNYRLTPSFEYQPDPWNTHV WKGTNGTPTKRRAIGFKKLAEAVKFSAKLMGQAMAKRVKATILYATETGKSQAYAKTLCE IFKHAFDAKVMSMEEYDIVHLEHETLVLVVTSTFGNGDPPENGEKFGCALMEMRHPNSVQ EERKSYKVRFNSVSSYSDSQKSSGDGPDLRDNFESAGPLANVRFSVFGLGSRAYPHFCAF GHAVDTLLEELGGERILKMREGDELCGQEEAFRTWAKKVFKAACDVFCVGDDVNIEKANN SLISNDRSWKRNKFRLTFVAEAPELTQGLSNVHKKRVSAARLLSRQNLQSPKSSRSTIFV RLHTNGSQELQYQPGDHLGVFPGNHEDLVNALIERLEDAPPVNQMVKVELLEERNTALGV ISNWTDELRLPPCTIFQAFKYYLDITTPPTPLQLQQFASLATSEKEKQRLLVLSKGLQEY EEWKWGKNPTIVEVLEEFPSIQMPATLLLTQLSLLQPRYYSISSSPDMYPDEVHLTVAIV SYRTRDGEGPIHHGVCSSWLNRIQADELVPCFVRGAPSFHLPRNPQVPCILVGPGTGIAP FRSFWQQRQFDIQHKGMNPCPMVLVFGCRQSKIDHIYREETLQAKNKGVFRELYTAYSRE PDKPKKYVQDILQEQLAESVYRALKEQGGHIYVCGDVTMAADVLKAIQRIMTQQGKLSAE DAGVFISRMRDDNRYHEDIFGVTLRTYEVTNRLRSESIAFIEESKKDTDEVFSS Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
| ADReCS ID | BADD_A05675 | |||||
| HIT2.0 ID | T70VMI | |||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 2 Clinical Trial Drugs | + | ||||
| 1 | NXN-188 | Drug Info | Phase 2 | Migraine | [2] | |
| 2 | NXN-462 | Drug Info | Phase 2 | Headache | [1] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| Inhibitor | [+] 125 Inhibitor drugs | + | ||||
| 1 | NXN-188 | Drug Info | [3] | |||
| 2 | NXN-462 | Drug Info | [1] | |||
| 3 | L-NIL | Drug Info | [4] | |||
| 4 | ((E)-7-But-2-enyl)-azepan-(2Z)-ylideneamine | Drug Info | [5] | |||
| 5 | (+/-)-2-Methyl-1-(1-phenylethyl)-1H-imidazole | Drug Info | [6] | |||
| 6 | (4S,5R)-4,5-Diethyl-oxazolidin-(2Z)-ylideneamine | Drug Info | [7] | |||
| 7 | (4S,5R)-4,5-Dimethyl-oxazolidin-(2Z)-ylideneamine | Drug Info | [7] | |||
| 8 | (4S,5S)-4,5-Diethyl-oxazolidin-(2Z)-ylideneamine | Drug Info | [7] | |||
| 9 | (5-Imino-[1,4]thiazepan-3-yl)-methanol | Drug Info | [8] | |||
| 10 | (5S,6R)-[Octahydro-quinolin-(2E)-ylidene]amine | Drug Info | [9] | |||
| 11 | (5S,6S)-[Octahydro-quinolin-(2E)-ylidene]amine | Drug Info | [9] | |||
| 12 | (6r,1'r,2's)-5,6,7,8 Tetrahydrobiopterin | Drug Info | [10] | |||
| 13 | (R)-3-Propyl-[1,4]thiazepan-(5E)-ylideneamine | Drug Info | [8] | |||
| 14 | (S)-2-Amino-5-(N-methyl-guanidino)-pentanoic acid | Drug Info | [11] | |||
| 15 | (S)-3-Propyl-[1,4]thiazepan-(5E)-ylideneamine | Drug Info | [8] | |||
| 16 | (S)-6-Amino-2-(2-imino-ethylamino)-hexanoic acid | Drug Info | [8] | |||
| 17 | 1-(2-amino-benzothiazol-5-yl)-2-ethyl-isothiourea | Drug Info | [12] | |||
| 18 | 1-(2-amino-benzothiazol-6-yl)-2-ethyl-isothiourea | Drug Info | [12] | |||
| 19 | 1-(Benzhydrylamino)ethaniminium bromide | Drug Info | [6] | |||
| 20 | 1-Benzyl-2-methyl-1H-imidazole | Drug Info | [6] | |||
| 21 | 1-[(3-Methoxybenzyl)amino]ethaniminium chloride | Drug Info | [6] | |||
| 22 | 1400W | Drug Info | [6], [13] | |||
| 23 | 2'-Monophosphoadenosine 5'-Diphosphoribose | Drug Info | [10] | |||
| 24 | 2-(2-Amino-ethyl)-7-imino-azepane | Drug Info | [5] | |||
| 25 | 2-amino-4,6-dimethylpyridine | Drug Info | [14] | |||
| 26 | 2-amino-4-methylpyridine | Drug Info | [15] | |||
| 27 | 2-Amino-5-(N-nitro-guanidino)-pentanoic acid | Drug Info | [11] | |||
| 28 | 2-aminopyridine | Drug Info | [14] | |||
| 29 | 2-Aminothiazoline | Drug Info | [16] | |||
| 30 | 2-Methyl-[1,4]thiazepan-(5E)-ylideneamine | Drug Info | [8] | |||
| 31 | 3,4-Dihydro-1H-quinolin-(2E)-ylideneamine | Drug Info | [9] | |||
| 32 | 3,4-Dimethyl-pyrrolidin-(2Z)-ylideneamine | Drug Info | [16] | |||
| 33 | 3-(2-Amino-ethyl)-5-imino-[1,4]oxazepane | Drug Info | [5] | |||
| 34 | 3-(2-Nitro-ethyl)-[1,4]oxazepan-(5Z)-ylideneamine | Drug Info | [5] | |||
| 35 | 3-Bromo-1H-indazole-7-carbonitrile | Drug Info | [17] | |||
| 36 | 3-bromo-7-nitro-1H-indazole | Drug Info | [10], [18] | |||
| 37 | 3-Butyl-[1,4]thiazepan-(5E)-ylideneamine | Drug Info | [8] | |||
| 38 | 3-Ethyl-[1,4]thiazepan-(5E)-ylideneamine | Drug Info | [8] | |||
| 39 | 3-Isobutyl-[1,4]thiazepan-(5E)-ylideneamine | Drug Info | [8] | |||
| 40 | 3-Methyl-pyrrolidin-(2Z)-ylideneamine | Drug Info | [16] | |||
| 41 | 3-Methyl-[1,4]thiazepan-(5E)-ylideneamine | Drug Info | [8] | |||
| 42 | 3-Propyl-[1,4]thiazepan-(5E)-ylideneamine | Drug Info | [8] | |||
| 43 | 4,5,6,7-tetrafluoro-3-methyl-1H-indazole | Drug Info | [18] | |||
| 44 | 4,5-Dimethyl-pyrrolidin-(2Z)-ylideneamine | Drug Info | [16] | |||
| 45 | 4-bromo-1H-indazole | Drug Info | [19] | |||
| 46 | 4-Butyl-thiazolidin-(2E)-ylideneamine | Drug Info | [16] | |||
| 47 | 4-chloro-1H-indazole | Drug Info | [19] | |||
| 48 | 4-Ethyl-3-methyl-pyrrolidin-(2Z)-ylideneamine | Drug Info | [16] | |||
| 49 | 4-Ethyl-5-methyl-pyrrolidin-(2Z)-ylideneamine | Drug Info | [16] | |||
| 50 | 4-Ethyl-oxazolidin-(2Z)-ylideneamine | Drug Info | [7] | |||
| 51 | 4-Ethyl-pyrrolidin-(2Z)-ylideneamine | Drug Info | [16] | |||
| 52 | 4-iodo-1H-indazole | Drug Info | [19] | |||
| 53 | 4-Isopropyl-pyrrolidin-(2Z)-ylideneamine | Drug Info | [16] | |||
| 54 | 4-Methyl-5-propyl-pyrrolidin-(2Z)-ylideneamine | Drug Info | [16] | |||
| 55 | 4-methyl-6-propylpyridin-2-amine | Drug Info | [15] | |||
| 56 | 4-Methyl-oxazolidin-(2Z)-ylideneamine | Drug Info | [7] | |||
| 57 | 4-Methyl-piperidin-(2E)-ylideneamine | Drug Info | [9] | |||
| 58 | 4-Methyl-pyrrolidin-(2Z)-ylideneamine | Drug Info | [16] | |||
| 59 | 4-[(2-Methyl-1H-imidazol-1-yl)methyl]pyridine | Drug Info | [6] | |||
| 60 | 5-bromo-1H-indazole | Drug Info | [19] | |||
| 61 | 5-Bromomethyl-oxazolidin-(2Z)-ylideneamine | Drug Info | [7] | |||
| 62 | 5-chloro-1H-indazole | Drug Info | [19] | |||
| 63 | 5-Ethyl-3-methyl-pyrrolidin-(2Z)-ylideneamine | Drug Info | [16] | |||
| 64 | 5-Ethyl-4-methyl-pyrrolidin-(2Z)-ylideneamine | Drug Info | [16] | |||
| 65 | 5-Ethyl-4-propyl-pyrrolidin-(2Z)-ylideneamine | Drug Info | [16] | |||
| 66 | 5-Ethyl-oxazolidin-(2Z)-ylideneamine | Drug Info | [7] | |||
| 67 | 5-iodo-1H-indazole | Drug Info | [19] | |||
| 68 | 5-Methyl-oxazolidin-(2Z)-ylideneamine | Drug Info | [7] | |||
| 69 | 5-Methyl-pyrrolidin-(2Z)-ylideneamine | Drug Info | [16] | |||
| 70 | 5-N-Allyl-Arginine | Drug Info | [10] | |||
| 71 | 6-(2-Fluoropropyl)-4-methylpyridin-2-amine | Drug Info | [20] | |||
| 72 | 6-(3-Fluoropropyl)-4-methylpyridin-2-amine | Drug Info | [20] | |||
| 73 | 6-bromo-1H-indazole | Drug Info | [19] | |||
| 74 | 6-chloro-1H-indazole | Drug Info | [19] | |||
| 75 | 6-isobutyl-4-methylpyridin-2-amine | Drug Info | [20] | |||
| 76 | 7-(2-Nitro-ethyl)-azepan-(2Z)-ylideneamine | Drug Info | [5] | |||
| 77 | 7-bromo-1H-indazole | Drug Info | [19] | |||
| 78 | 7-Butyl-azepan-(2Z)-ylideneamine | Drug Info | [5] | |||
| 79 | 7-chloro-1H-indazole | Drug Info | [19] | |||
| 80 | 7-Methoxy-1H-indazole | Drug Info | [21] | |||
| 81 | 7-Methyl-[1,4]thiazepan-(5E)-ylideneamine | Drug Info | [8] | |||
| 82 | 7-nitro-1H-indazole | Drug Info | [18] | |||
| 83 | Acetate Ion | Drug Info | [10] | |||
| 84 | Alpha-D-Mannose | Drug Info | [10] | |||
| 85 | AR-C102222 | Drug Info | [15] | |||
| 86 | AR-C133057XX | Drug Info | [15] | |||
| 87 | Azepan-(2Z)-ylideneamine | Drug Info | [5] | |||
| 88 | Azocan-(2Z)-ylideneamine | Drug Info | [5] | |||
| 89 | Azonan-(2Z)-ylideneamine | Drug Info | [11] | |||
| 90 | EUSYNSTYELAMIDE B | Drug Info | [22] | |||
| 91 | Eusynstyelamide C | Drug Info | [22] | |||
| 92 | Flavin-Adenine Dinucleotide | Drug Info | [10] | |||
| 93 | Formic Acid | Drug Info | [10] | |||
| 94 | Heme | Drug Info | [13] | |||
| 95 | Hexahydro-cyclopenta[b]pyrrol-(2Z)-ylideneamine | Drug Info | [16] | |||
| 96 | Hexahydro-cyclopenta[c]pyrrol-(1Z)-ylideneamine | Drug Info | [16] | |||
| 97 | Hexahydro-pyrrolizin-(3E)-ylideneamine | Drug Info | [16] | |||
| 98 | L-NIO | Drug Info | [23] | |||
| 99 | N*1*-(5-Methyl-2-nitro-phenyl)-butane-1,4-diamine | Drug Info | [24] | |||
| 100 | N-(5-Amino-6-oxo-heptyl)-acetamidine | Drug Info | [16] | |||
| 101 | N-Butyl-N'-Hydroxyguanidine | Drug Info | [10] | |||
| 102 | N-Isopropyl-N'-Hydroxyguanidine | Drug Info | [10] | |||
| 103 | N-omega-allyl-L-arginine | Drug Info | [23] | |||
| 104 | N-Omega-Hydroxy-L-Arginine | Drug Info | [10] | |||
| 105 | N-omega-propargyl-L-arginine | Drug Info | [23] | |||
| 106 | N-Omega-Propyl-L-Arginine | Drug Info | [10] | |||
| 107 | N5-(1-Imino-3-Butenyl)-L-Ornithine | Drug Info | [10] | |||
| 108 | N5-(1-iminobut-3-enyl)-L-ornithine | Drug Info | [23] | |||
| 109 | N5-(1-iminobutyl)-L-ornithine | Drug Info | [23] | |||
| 110 | N5-(1-iminopent-3-enyl)-L-ornithine | Drug Info | [23] | |||
| 111 | N5-(1-iminopropyl)-L-ornithine | Drug Info | [23] | |||
| 112 | Nitroarginine | Drug Info | [25] | |||
| 113 | Octahydro-isoindol-(1Z)-ylideneamine | Drug Info | [16] | |||
| 114 | Piperidin-(2E)-ylideneamine | Drug Info | [9] | |||
| 115 | Pyrrolidin-(2Z)-ylideneamine | Drug Info | [16] | |||
| 116 | S-Ethyl-N-Phenyl-Isothiourea | Drug Info | [13] | |||
| 117 | S-Ethyl-N-[4-(Trifluoromethyl)Phenyl]Isothiourea | Drug Info | [13] | |||
| 118 | Tetrahydro-pyrimidin-2-ylideneamine | Drug Info | [11] | |||
| 119 | THIOCITRULLINE | Drug Info | [26] | |||
| 120 | [1,3]Oxazinan-(2E)-ylideneamine | Drug Info | [11] | |||
| 121 | [1,3]Thiazinan-(2E)-ylideneamine | Drug Info | [11] | |||
| 122 | [1,4]Oxazepan-(3E)-ylideneamine | Drug Info | [8] | |||
| 123 | [1,4]Oxazepan-(5E)-ylideneamine | Drug Info | [8] | |||
| 124 | [1,4]Thiazepan-(3E)-ylideneamine | Drug Info | [8] | |||
| 125 | [1,4]Thiazepan-(5E)-ylideneamine | Drug Info | [8] | |||
| Chemical Structure based Activity Landscape of Target | Top |
|---|---|
| Drug Property Profile of Target | Top | |
|---|---|---|
| (1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
|
||
| (3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
|
||
| (5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
|
||
| "RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five | ||
| Target Poor or Non Binders | Top | |||||
|---|---|---|---|---|---|---|
| Target Poor or Non Binders | ||||||
| Target Regulators | Top | |||||
|---|---|---|---|---|---|---|
| Target-regulating microRNAs | ||||||
| Target-interacting Proteins | ||||||
| Target Profiles in Patients | Top | |||||
|---|---|---|---|---|---|---|
| Target Expression Profile (TEP) | ||||||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| BioCyc | [+] 1 BioCyc Pathways | + | ||||
| 1 | Citrulline-nitric oxide cycle | |||||
| KEGG Pathway | [+] 9 KEGG Pathways | + | ||||
| 1 | Arginine and proline metabolism | |||||
| 2 | Metabolic pathways | |||||
| 3 | Calcium signaling pathway | |||||
| 4 | Phagosome | |||||
| 5 | Circadian entrainment | |||||
| 6 | Long-term depression | |||||
| 7 | Salivary secretion | |||||
| 8 | Alzheimer's disease | |||||
| 9 | Amyotrophic lateral sclerosis (ALS) | |||||
| NetPath Pathway | [+] 1 NetPath Pathways | + | ||||
| 1 | EGFR1 Signaling Pathway | |||||
| Panther Pathway | [+] 1 Panther Pathways | + | ||||
| 1 | CCKR signaling map ST | |||||
| Pathwhiz Pathway | [+] 1 Pathwhiz Pathways | + | ||||
| 1 | Arginine and Proline Metabolism | |||||
| Reactome | [+] 2 Reactome Pathways | + | ||||
| 1 | ROS production in response to bacteria | |||||
| 2 | Nitric oxide stimulates guanylate cyclase | |||||
| WikiPathways | [+] 8 WikiPathways | + | ||||
| 1 | Monoamine Transport | |||||
| 2 | Myometrial Relaxation and Contraction Pathways | |||||
| 3 | Amyotrophic lateral sclerosis (ALS) | |||||
| 4 | Quercetin and Nf-kB/ AP-1 Induced Cell Apoptosis | |||||
| 5 | Spinal Cord Injury | |||||
| 6 | Alzheimers Disease | |||||
| 7 | Effects of Nitric Oxide | |||||
| 8 | Serotonin Transporter Activity | |||||
| Target-Related Models and Studies | Top | |||||
|---|---|---|---|---|---|---|
| Target Validation | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | ClinicalTrials.gov (NCT01748877) Efficacy, Tolerability, and Safety of NXN-462 in Patients With Post-Herpetic Neuralgia. U.S. National Institutes of Health. | |||||
| REF 2 | ClinicalTrials.gov (NCT00920686) Study of NXN 188 for the Treatment of Migraine With Aura. U.S. National Institutes of Health. | |||||
| REF 3 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 4 | Discovery of a series of aminopiperidines as novel iNOS inhibitors. Bioorg Med Chem Lett. 2008 Jan 1;18(1):336-43. | |||||
| REF 5 | Selective heterocyclic amidine inhibitors of human inducible nitric oxide synthase. Bioorg Med Chem Lett. 2001 Oct 8;11(19):2651-3. | |||||
| REF 6 | N-Substituted acetamidines and 2-methylimidazole derivatives as selective inhibitors of neuronal nitric oxide synthase. Bioorg Med Chem Lett. 2010 Nov 15;20(22):6495-9. | |||||
| REF 7 | 4,5-Disubstituted-1,3-oxazolidin-2-imine derivatives: a new class of orally bioavailable nitric oxide synthase inhibitor. Bioorg Med Chem Lett. 2004 Jan 19;14(2):313-6. | |||||
| REF 8 | Synthesis of analogs of (1,4)-3- and 5-imino oxazepane, thiazepane, and diazepane as inhibitors of nitric oxide synthases. Bioorg Med Chem Lett. 2004 Dec 6;14(23):5907-11. | |||||
| REF 9 | Bicyclic amidine inhibitors of nitric oxide synthase: discovery of perhydro-iminopyrindine and perhydro-iminoquinoline as potent, orally active inh... Bioorg Med Chem Lett. 2005 Apr 15;15(8):1997-2001. | |||||
| REF 10 | How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | |||||
| REF 11 | 2-Iminopiperidine and other 2-iminoazaheterocycles as potent inhibitors of human nitric oxide synthase isoforms. J Med Chem. 1996 Feb 2;39(3):669-72. | |||||
| REF 12 | Novel 2-aminobenzothiazoles as selective neuronal nitric oxide synthase inhibitors. Bioorg Med Chem Lett. 2007 May 1;17(9):2540-4. | |||||
| REF 13 | The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. | |||||
| REF 14 | L337H mutant of rat neuronal nitric oxide synthase resembles human neuronal nitric oxide synthase toward inhibitors. J Med Chem. 2009 Jul 23;52(14):4533-7. | |||||
| REF 15 | Anchored plasticity opens doors for selective inhibitor design in nitric oxide synthase. Nat Chem Biol. 2008 Nov;4(11):700-7. | |||||
| REF 16 | Evaluation of pyrrolidin-2-imines and 1,3-thiazolidin-2-imines as inhibitors of nitric oxide synthase. Bioorg Med Chem Lett. 2004 Sep 6;14(17):4539-44. | |||||
| REF 17 | Inhibitory effects of a series of 7-substituted-indazoles toward nitric oxide synthases: particular potency of 1H-indazole-7-carbonitrile. Bioorg Med Chem. 2008 Jun 1;16(11):5962-73. | |||||
| REF 18 | Fluorinated indazoles as novel selective inhibitors of nitric oxide synthase (NOS): synthesis and biological evaluation. Bioorg Med Chem. 2009 Sep 1;17(17):6180-7. | |||||
| REF 19 | 4-substituted indazoles as new inhibitors of neuronal nitric oxide synthase. Bioorg Med Chem Lett. 2007 Jun 1;17(11):3177-80. | |||||
| REF 20 | Design and synthesis of 2-amino-4-methylpyridine analogues as inhibitors for inducible nitric oxide synthase and in vivo evaluation of [18F]6-(2-fl... J Med Chem. 2009 Apr 23;52(8):2443-53. | |||||
| REF 21 | Inhibition of neuronal nitric oxide synthase by 7-methoxyindazole and related substituted indazoles. Bioorg Med Chem Lett. 2001 May 7;11(9):1153-6. | |||||
| REF 22 | Eusynstyelamides A, B, and C, nNOS inhibitors, from the ascidian Eusynstyela latericius. J Nat Prod. 2009 Jun;72(6):1115-20. | |||||
| REF 23 | Structure-activity relationship of novel and known inhibitors of human dimethylarginine dimethylaminohydrolase-1: alkenyl-amidines as new leads. Bioorg Med Chem. 2008 Dec 15;16(24):10205-9. | |||||
| REF 24 | Nitroaromatic amino acids as inhibitors of neuronal nitric oxide synthase. J Med Chem. 1998 Jul 2;41(14):2636-42. | |||||
| REF 25 | Crystal structure of nitric oxide synthase bound to nitro indazole reveals a novel inactivation mechanism. Biochemistry. 2001 Nov 13;40(45):13448-55. | |||||
| REF 26 | Evaluation of 3-substituted arginine analogs as selective inhibitors of human nitric oxide synthase isozymes. Bioorg Med Chem Lett. 2005 Jun 2;15(11):2881-5. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.