Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T16047
(Former ID: TTDS00120)
|
|||||
Target Name |
Onchocerca Glutamate-gated chloride channel (Onchoc GluCl)
|
|||||
Synonyms |
Glutamate-gated chloride channel
Click to Show/Hide
|
|||||
Gene Name |
Onchoc GluCl
|
|||||
Target Type |
Successful target
|
[1] | ||||
Disease | [+] 2 Target-related Diseases | + | ||||
1 | Onchocerciasis [ICD-11: 1F6A] | |||||
2 | Strongyloidiasis [ICD-11: 1F6B] | |||||
Function |
As postsynaptic receptors within the crustacean stomatogastric ganglion.
Click to Show/Hide
|
|||||
BioChemical Class |
Ion transport
|
|||||
UniProt ID | ||||||
Sequence |
MNSFPIVCWNLAFLILVVAKKKLKEQEIIQRTLKDYDWRVRPRGNNLSWPDTGGPVLVSV
NIYLRSISKIDDVNMEYSAQFTFREEWNDARLGYERLADENTQVPPFVVLAASEQPDLTQ QIWMPDTFFQNEKEARRHLIDKPNVLIRIHPDGQILYSVRLSLVLSCPMSLEYYPLDRQT CLIDLASYAYTTDDIKYEWKVKNPIQQKEGLRQSLPSFELQDVLTEYCTSKTNTGEYSCA RVLLLLRREYRFSYYLIQLYIPCIMLVVVSWVSFWLDKDAVPARVSLGVTTLLTMTTQAS GINAKLPPVSYIKAVDVWIGVCLAFIFGALLEYALVNYHGRQEFLKKEKKK Click to Show/Hide
|
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Approved Drug(s) | [+] 2 Approved Drugs | + | ||||
1 | Ivermectin | Drug Info | Approved | Intestinal strongyloidiasis due to nematode parasite | [2], [3] | |
2 | Moxidectin | Drug Info | Approved | River blindness | [4] | |
Mode of Action | [+] 2 Modes of Action | + | ||||
Activator | [+] 1 Activator drugs | + | ||||
1 | Ivermectin | Drug Info | [1] | |||
Modulator | [+] 1 Modulator drugs | + | ||||
1 | Moxidectin | Drug Info | [4] |
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
There is no similarity protein (E value < 0.005) for this target
|
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Inhibitory neurotransmission and olfactory memory in honeybees. Neurobiol Learn Mem. 2008 Nov;90(4):589-95. | |||||
REF 2 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2373). | |||||
REF 3 | Opportunities and challenges in antiparasitic drug discovery. Nat Rev Drug Discov. 2005 Sep;4(9):727-40. | |||||
REF 4 | 2018 FDA drug approvals.Nat Rev Drug Discov. 2019 Feb;18(2):85-89. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.