Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T13409
(Former ID: TTDI02209)
|
|||||
| Target Name |
Human immunodeficiency virus Matrix p17 (HIV MA)
|
|||||
| Synonyms |
gag
Click to Show/Hide
|
|||||
| Gene Name |
HIV MA
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Human immunodeficiency virus disease [ICD-11: 1C60-1C62] | |||||
| Function |
p6-gag: Plays a role in budding of the assembled particle by interacting with the host class E VPS proteins TSG101 and PDCD6IP/AIP1.
Click to Show/Hide
|
|||||
| UniProt ID | ||||||
| Sequence |
GARASVLSGGELDRWEKIRLRPGGKKKYKLKHIVWASRELERFAVNPGLLETSEGCRQIL
GQLQPSLQTGSEELRSLYNTVATLYCVHQRIEIKDTKEALDKIEEEQNKSKKKAQQAAAD TGHSSQVSQNY Click to Show/Hide
|
|||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 1 Clinical Trial Drugs | + | ||||
| 1 | F4co vaccine | Drug Info | Phase 2 | Human immunodeficiency virus infection | [2], [3] | |
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| Reactome | [+] 14 Reactome Pathways | + | ||||
| 1 | Uncoating of the HIV Virion | |||||
| 2 | Budding and maturation of HIV virion | |||||
| 3 | Integration of provirus | |||||
| 4 | Early Phase of HIV Life Cycle | |||||
| 5 | Minus-strand DNA synthesis | |||||
| 6 | Plus-strand DNA synthesis | |||||
| 7 | 2-LTR circle formation | |||||
| 8 | Binding and entry of HIV virion | |||||
| 9 | Membrane binding and targetting of GAG proteins | |||||
| 10 | Assembly Of The HIV Virion | |||||
| 11 | Integration of viral DNA into host genomic DNA | |||||
| 12 | Autointegration results in viral DNA circles | |||||
| 13 | APOBEC3G mediated resistance to HIV-1 infection | |||||
| 14 | Vpr-mediated nuclear import of PICs | |||||
| WikiPathways | [+] 2 WikiPathways | + | ||||
| 1 | Host Interactions of HIV factors | |||||
| 2 | HIV Life Cycle | |||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | EP patent application no. 2621528, Vaccine. | |||||
| REF 2 | ClinicalTrials.gov (NCT01218113) Efficacy and Safety of GSK Biologicals HIV Vaccine in Antiretroviral Therapy (ART)-naive HIV-1 Infected Persons. U.S. National Institutes of Health. | |||||
| REF 3 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027409) | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.