Target Information

Target General Information

Target ID

T12126 (Former ID: TTDR00341)

Target Name

Mixed lineage kinase 3 (MAP3K11)

Synonyms

Src-homology 3 domain-containing proline-rich kinase; SPRK; SH3 domain-containing proline-rich kinase; Protein-tyrosine kinase PTK1; PTK1; Mixed-lineage protein kinase 3; Mitogen-activated protein kinase kinase kinase 11; MLK3

Click to Show/Hide

Gene Name

MAP3K11

Target Type

Literature-reported target

[1]

Function

Required for serum-stimulated cell proliferation and for mitogen and cytokine activation of MAPK14 (p38), MAPK3 (ERK) and MAPK8 (JNK1) through phosphorylation and activation of MAP2K4/MKK4 and MAP2K7/MKK7. Plays a role in mitogen-stimulated phosphorylation and activation of BRAF, but does not phosphorylate BRAF directly. Influences microtubule organization during the cell cycle. Activates the JUN N-terminal pathway.

Click to Show/Hide

BioChemical Class

Kinase

UniProt ID

M3K11_HUMAN

EC Number

EC 2.7.11.25

Sequence

MEPLKSLFLKSPLGSWNGSGSGGGGGGGGGRPEGSPKAAGYANPVWTALFDYEPSGQDEL
ALRKGDRVEVLSRDAAISGDEGWWAGQVGGQVGIFPSNYVSRGGGPPPCEVASFQELRLE
EVIGIGGFGKVYRGSWRGELVAVKAARQDPDEDISVTAESVRQEARLFAMLAHPNIIALK
AVCLEEPNLCLVMEYAAGGPLSRALAGRRVPPHVLVNWAVQIARGMHYLHCEALVPVIHR
DLKSNNILLLQPIESDDMEHKTLKITDFGLAREWHKTTQMSAAGTYAWMAPEVIKASTFS
KGSDVWSFGVLLWELLTGEVPYRGIDCLAVAYGVAVNKLTLPIPSTCPEPFAQLMADCWA
QDPHRRPDFASILQQLEALEAQVLREMPRDSFHSMQEGWKREIQGLFDELRAKEKELLSR
EEELTRAAREQRSQAEQLRRREHLLAQWELEVFERELTLLLQQVDRERPHVRRRRGTFKR
SKLRARDGGERISMPLDFKHRITVQASPGLDRRRNVFEVGPGDSPTFPRFRAIQLEPAEP
GQAWGRQSPRRLEDSSNGERRACWAWGPSSPKPGEAQNGRRRSRMDEATWYLDSDDSSPL
GSPSTPPALNGNPPRPSLEPEEPKRPVPAERGSSSGTPKLIQRALLRGTALLASLGLGRD
LQPPGGPGRERGESPTTPPTPTPAPCPTEPPPSPLICFSLKTPDSPPTPAPLLLDLGIPV
GQRSAKSPRREEEPRGGTVSPPPGTSRSAPGTPGTPRSPPLGLISRPRPSPLRSRIDPWS
FVSAGPRPSPLPSPQPAPRRAPWTLFPDSDPFWDSPPANPFQGGPQDCRAQTKDMGAQAP
WVPEAGP

Click to Show/Hide

3D Structure

Click to Show 3D Structure of This Target

AlphaFold

HIT2.0 ID

T45I46

Cell-based Target Expression Variations

Top

Cell-based Target Expression Variations

Cell-based Target Expression Variations Info

Different Human System Profiles of Target	Top
Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target. A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020). Human Pathway Affiliation of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function. Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes (Pharmacol Rev, 58: 259-279, 2006). Biological Network Descriptors of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database. The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information (Front Pharmacol, 9, 1245, 2018; Curr Opin Struct Biol. 44:134-142, 2017). Human Similarity Proteins Human Pathway Affiliation Biological Network Descriptors

Different Human System Profiles of Target

Top

Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.

A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020).

Human Pathway Affiliation of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function.

Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes (Pharmacol Rev, 58: 259-279, 2006).

Biological Network Descriptors of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database.

The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information (Front Pharmacol, 9, 1245, 2018; Curr Opin Struct Biol. 44:134-142, 2017).

Human Similarity Proteins

Human Pathway Affiliation

Biological Network Descriptors

Protein Name	Pfam ID	Percentage of Identity (%)	E value
SPS1/STE20-related protein kinase YSK4 (YSK4)	PF00069	32.714 (88/269)	1.23E-35
Serine/threonine-protein kinase Nek11 (NEK11)	PF00069	27.211 (80/294)	2.62E-27
Protein kinase C beta (PRKCB)	PF00130 ; PF00168 ; PF00069 ; PF00433 More >>	33.333 (80/240)	6.43E-26
Omphalocele kinase 1 (NUAK1)	PF00069	33.178 (71/214)	1.02E-25
MAPK/ERK kinase kinase 1 (MAP3K1)	PF00069	30.970 (83/268)	3.12E-25
Serine/threonine-protein kinase Nek3 (NEK3)	PF00069	30.268 (79/261)	3.53E-25
Serine/threonine-protein kinase Nek4 (NEK4)	PF00069	29.779 (81/272)	3.90E-25
NIMA-related kinase 7 (NEK7)	PF00069	28.214 (79/280)	1.27E-24
Serine/threonine-protein kinase ULK1 (ULK1)	PF12063 ; PF00069	30.597 (82/268)	1.38E-24
Protein kinase C delta (PRKCD)	PF00130 ; PF00069 ; PF00433 More >>	32.035 (74/231)	3.35E-24
Serine/threonine-protein kinase MARK2 (MARK2)	PF02149 ; PF00069 ; PF00627 More >>	30.566 (81/265)	4.93E-24
Serine/threonine-protein kinase Nek5 (NEK5)	PF00069	26.502 (75/283)	7.22E-24
NUAK family SNF1-like kinase 2 (NUAK2)	PF00069	32.381 (68/210)	8.16E-24
Serine/threonine-protein kinase WNK4 (WNK4)	PF12202 ; PF00069	31.674 (70/221)	9.15E-24
Serine/threonine-protein kinase Nek8 (NEK8)	PF00069 ; PF00415	27.203 (71/261)	1.23E-23
Serine/threonine-protein kinase ULK2 (ULK2)	PF12063 ; PF00069	33.184 (74/223)	1.40E-23
NIMA-related kinase 6 (NEK6)	PF00069	28.322 (81/286)	1.87E-23
Ribosomal protein S6 kinase alpha-2 (RSK2)	PF00069 ; PF00433	33.484 (74/221)	1.92E-23
Serine/threonine-protein kinase MARK1 (MARK1)	PF02149 ; PF00069 ; PF00627 More >>	30.483 (82/269)	2.06E-23
Unc-51 like kinase 3 (ULK3)	PF04212 ; PF00069	29.278 (77/263)	3.81E-23
Protein kinase C alpha (PRKCA)	PF00130 ; PF00168 ; PF00069 ; PF00433 More >>	31.950 (77/241)	4.87E-23
Ribosomal protein S6 kinase alpha-1 (RSK1)	PF00069 ; PF00433	32.489 (77/237)	7.60E-23
Receptor-interacting serine/threonine-protein kinase 3 (RIPK3)	PF00069 ; PF12721	30.351 (95/313)	8.68E-23
Myosin light chain kinase 3 (MYLK3)	PF00069	30.973 (70/226)	1.01E-22
Protein kinase C theta (PRKCQ)	PF00130 ; PF00069 ; PF00433 More >>	30.769 (68/221)	1.06E-22
RAC-beta serine/threonine-protein kinase (AKT2)	PF00169 ; PF00069 ; PF00433 More >>	30.268 (79/261)	2.13E-22
RAC-alpha serine/threonine-protein kinase (AKT1)	PF00169 ; PF00069 ; PF00433 More >>	29.213 (78/267)	2.40E-22
Ribosomal protein S6 kinase alpha-4 (RPS6KA4)	PF00069 ; PF00433	32.143 (72/224)	2.64E-22
Microtubule affinity regulating kinase 3 (MARK3)	PF02149 ; PF00069 ; PF00627 More >>	29.478 (79/268)	2.86E-22
Leucine-rich repeat serine/threonine-protein kinase 1 (LRRK1)	PF12796 ; PF16095 ; PF00069 ; PF08477 More >>	30.208 (87/288)	3.30E-22
Serine/threonine-protein kinase PAK 3 (PAK3)	PF00786 ; PF00069	29.008 (76/262)	3.36E-22
Serine/threonine-protein kinase 25 (STK25)	PF00069	29.730 (77/259)	3.80E-22
Ribosomal protein S6 kinase alpha-3 (RSK3)	PF00069 ; PF00433	31.646 (75/237)	3.88E-22
PAK-1 protein kinase (PAK1)	PF00786 ; PF00069	28.626 (75/262)	4.11E-22
PAK-2 protein kinase (PAK2)	PF00786 ; PF00069	28.626 (75/262)	5.21E-22
Serine/threonine-protein kinase 24 (STK24)	PF00069	27.698 (77/278)	5.44E-22
NIMA-related kinase 1 (NEK1)	PF00069	25.185 (68/270)	5.81E-22
MAP/microtubule affinity-regulating kinase 4 (MARK4)	PF02149 ; PF00069 ; PF00627 More >>	31.466 (73/232)	5.95E-22
Serine/threonine-protein kinase Nek10 (NEK10)	PF00069	26.263 (78/297)	6.25E-22
MAPK/ERK kinase kinase 2 (MAP3K2)	PF00564 ; PF00069	30.736 (71/231)	7.47E-22
Calcium/calmodulin-dependent protein kinase type 1G (CAMK1G)	PF00069	31.707 (65/205)	1.18E-21
WNK lysine-deficient protein kinase 3 (WNK3)	PF12202 ; PF00069	27.941 (76/272)	1.75E-21
RAC-gamma serine/threonine-protein kinase (AKT3)	PF00169 ; PF00069 ; PF00433 More >>	28.030 (74/264)	2.48E-21
Serine/threonine-protein kinase TAO2 (TAOK2)	PF00069	29.841 (94/315)	4.15E-21
Protein kinase C gamma (PRKCG)	PF00130 ; PF00168 ; PF00069 ; PF00433 More >>	31.746 (80/252)	4.56E-21
Serine/threonine-protein kinase WNK2 (WNK2)	PF12202 ; PF00069	27.509 (74/269)	6.14E-21
Myosin light kinase (MYLK)	PF16620 ; PF00041 ; PF07679 ; PF00069 More >>	27.556 (62/225)	6.28E-21
STE20-related serine/threonine-protein kinase (SLK)	PF00069 ; PF12474	29.213 (78/267)	6.48E-21
SNF-related serine/threonine-protein kinase (SNRK)	PF00069	25.769 (67/260)	8.56E-21
PKC-delta-interacting protein kinase (RIPK4)	PF12796 ; PF00069	30.420 (87/286)	1.03E-20
Serine/threonine-protein kinase 33 (STK33)	PF00069	29.612 (61/206)	1.05E-20
Ribosomal protein S6 kinase alpha-5 (RSK5)	PF00069 ; PF00433	31.111 (70/225)	1.18E-20
Ribosomal protein S6 kinase alpha-6 (RSK6)	PF00069 ; PF00433	30.667 (69/225)	1.22E-20
ERK activator kinase 5 (MAP2K5)	PF00564 ; PF00069	26.119 (70/268)	1.37E-20
Ribosomal protein S6 kinase beta-1 (S6K1)	PF00069 ; PF00433	28.016 (72/257)	1.49E-20
MAPK/ERK kinase kinase 4 (MAP3K4)	PF19431 ; PF00069	28.906 (74/256)	1.88E-20
TAO kinase 1 (TAOK1)	PF00069	29.206 (92/315)	1.98E-20
Serine/threonine-protein kinase WNK1 (WNK1)	PF12202 ; PF00069	27.574 (75/272)	2.28E-20
cAMP-dependent protein kinase catalytic subunit gamma (PRKACG)	PF00069	30.568 (70/229)	2.87E-20
Aurora kinase A (AURKA)	PF00069	26.563 (68/256)	2.90E-20
IL-1 receptor-associated kinase 1 (IRAK1)	PF00531 ; PF00069	30.043 (70/233)	4.46E-20
Serine/threonine-protein kinase 10 (STK10)	PF00069 ; PF12474	28.519 (77/270)	5.15E-20
Hormonally up-regulated neu tumor-associated kinase (HUNK)	PF00069	27.692 (72/260)	5.18E-20
MAPK/ERK kinase kinase 3 (MAP3K3)	PF00564 ; PF00069	30.290 (73/241)	6.78E-20
MST-1 protein kinase (STK4)	PF11629 ; PF00069	25.000 (74/296)	7.08E-20
Cyclin-dependent kinase 3 (CDK3)	PF00069	32.547 (69/212)	7.27E-20
BR serine/threonine kinase 1 (BRSK1)	PF00069	28.571 (68/238)	1.10E-19
Leucine-rich repeat kinase 2 (LRRK2)	PF16095 ; PF12799 ; PF13855 ; PF00069 ; PF08477 More >>	33.824 (69/204)	1.37E-19
Serine/threonine-protein kinase Nek9 (NEK9)	PF00069 ; PF00415	25.524 (73/286)	1.47E-19
Polo-like kinase 4 (PLK4)	PF00069 ; PF18190 ; PF18409 More >>	26.812 (74/276)	1.47E-19
Protein kinase N1 (PKN1)	PF02185 ; PF00069 ; PF00433 More >>	29.412 (70/238)	1.61E-19
Protein kinase N2 (PKN2)	PF02185 ; PF00069 ; PF00433 More >>	29.707 (71/239)	1.82E-19
SIK family kinase 3 (SIK3)	PF00069	25.362 (70/276)	2.55E-19
Myosin light chain kinase family member 4 (MYLK4)	PF00069	30.594 (67/219)	3.24E-19
Calcium/calmodulin-dependent protein kinase type 1D (CAMK1D)	PF00069	32.701 (69/211)	3.47E-19
TRAF2 and NCK interacting kinase (TNIK)	PF00780 ; PF00069	25.540 (71/278)	4.19E-19
Proto-oncogene serine/threonine-protein kinase mos (MOS)	PF00069	25.000 (78/312)	4.53E-19
Ribosomal protein S6 kinase beta-2 (RPS6KB2)	PF00069 ; PF00433	27.778 (65/234)	5.51E-19
cAMP-dependent protein kinase catalytic subunit PRKX (PRKX)	PF00069	28.936 (68/235)	5.82E-19
Obscurin (OBSCN)	PF00041 ; PF07679 ; PF00612 ; PF00069 ; PF00621 More >>	27.434 (93/339)	6.23E-19
Fused homolog (STK36)	PF13646 ; PF00069	25.758 (68/264)	6.67E-19
Protein kinase C epsilon (PRKCE)	PF00130 ; PF00168 ; PF00069 ; PF00433 More >>	30.275 (66/218)	7.83E-19
5'-AMP-activated protein kinase catalytic subunit alpha-1 (PRKAA1)	PF16579 ; PF00069	32.057 (67/209)	8.47E-19
Serine/threonine-protein kinase PAK 5 (PAK5)	PF00786 ; PF00069	29.187 (61/209)	9.70E-19
Serine/threonine-protein kinase 26 (STK26)	PF00069	27.586 (72/261)	9.85E-19
Salt-inducible kinase 2 (SIK2)	PF00069	29.070 (75/258)	9.88E-19
Protein kinase C iota (PRKCI)	PF00130 ; PF00564 ; PF00069 ; PF00433 More >>	29.358 (64/218)	9.88E-19
Polo-like kinase 2 (PLK2)	PF00069 ; PF00659	25.573 (67/262)	1.07E-18
Protein kinase D (PRKD1)	PF00130 ; PF00169 ; PF00069 More >>	30.594 (67/219)	1.18E-18
TAO kinase 3 (TAOK3)	PF00069	31.203 (83/266)	1.23E-18
Serine/threonine-protein kinase PAK 6 (PAK6)	PF00786 ; PF00069	29.245 (62/212)	1.26E-18
Protein kinase C eta type (PRKCH)	PF00130 ; PF00168 ; PF00069 ; PF00433 More >>	31.532 (70/222)	1.29E-18
Serine/threonine-protein kinase D3 (PRKD3)	PF00130 ; PF00169 ; PF00069 More >>	29.864 (66/221)	1.61E-18
Serine/threonine-protein kinase 3 (STK3)	PF11629 ; PF00069	25.191 (66/262)	1.96E-18
Calcium/calmodulin-dependent protein kinase type 1B (PNCK)	PF00069	30.556 (66/216)	2.07E-18
5'-AMP-activated protein kinase catalytic subunit alpha-2 (PRKAA2)	PF16579 ; PF00069	31.579 (66/209)	2.45E-18
PAK-4 protein kinase (PAK4)	PF00786 ; PF00069	29.902 (61/204)	2.47E-18
Myosin-IIIb (MYO3B)	PF00612 ; PF00063 ; PF00069 More >>	28.223 (81/287)	2.52E-18
Death-associated protein kinase 3 (DAPK3)	PF00069	27.679 (62/224)	2.72E-18
Inhibitor of nuclear factor kappa-B kinase beta (IKKB)	PF18397 ; PF12179 ; PF00069 More >>	32.727 (72/220)	3.03E-18
Misshapen-like kinase 1 (MINK1)	PF00780 ; PF00069	29.333 (66/225)	3.20E-18
Beta-adrenergic receptor kinase 2 (ADRBK2)	PF00169 ; PF00069 ; PF00615 More >>	27.419 (68/248)	3.46E-18
Serine/threonine-protein kinase Sgk3 (SGK3)	PF00069 ; PF00433 ; PF00787 More >>	30.000 (72/240)	3.67E-18
Mitogen-activated protein kinase kinase kinase kinase 5 (MAP4K5)	PF00780 ; PF00069	31.100 (65/209)	3.77E-18
Myosin light chain kinase 2 (MYLK2)	PF00069	30.357 (68/224)	4.20E-18
Cyclin-dependent kinase 1 (CDK1)	PF00069	31.455 (67/213)	4.25E-18
MEK kinase kinase 2 (MAP4K2)	PF00780 ; PF00069	31.401 (65/207)	4.37E-18
BR serine/threonine kinase 2 (BRSK2)	PF00069	29.384 (62/211)	4.70E-18
PDZ binding kinase (PBK)	PF00069	25.197 (64/254)	7.50E-18
Serine/threonine-protein kinase D2 (PRKD2)	PF00130 ; PF00069	31.507 (69/219)	8.55E-18
cAMP-dependent protein kinase catalytic subunit beta (PRKACB)	PF00069	29.075 (66/227)	8.91E-18
Protein kinase G2 (PRKG2)	PF00027 ; PF00069	31.336 (68/217)	9.44E-18
ERK activator kinase 7 (MAP2K7)	PF00069	27.331 (85/311)	9.71E-18
Maternal embryonic leucine zipper kinase (MELK)	PF02149 ; PF00069	27.599 (77/279)	1.07E-17
Calcium/calmodulin-dependent protein kinase type II subunit alpha (CAMK2A)	PF08332 ; PF00069	31.336 (68/217)	1.34E-17
CaM-kinase IV kinase (CAMKK1)	PF00069	30.698 (66/215)	1.50E-17
Doublecortin-like kinase 3 (DCLK3)	PF00069	28.571 (58/203)	1.64E-17
Calcium/calmodulin-dependent protein kinase type II subunit beta (CAMK2B)	PF08332 ; PF00069	31.019 (67/216)	1.75E-17
Mitogen-activated protein kinase kinase kinase 15 (MAP3K15)	PF19039 ; PF20309 ; PF20302 ; PF13281 ; PF00069 More >>	27.203 (71/261)	1.80E-17
cAMP-dependent protein kinase catalytic subunit alpha (PRKACA)	PF00069	27.386 (66/241)	1.91E-17
IL-1 receptor-associated kinase 3 (IRAK3)	PF00531 ; PF00069	26.936 (80/297)	2.03E-17
Serine/threonine-protein kinase STK11 (STK11)	PF00069	28.761 (65/226)	2.33E-17
Serine/threonine-protein kinase Sgk1 (SGK1)	PF00069 ; PF00433	30.131 (69/229)	2.47E-17
Cyclin-dependent kinase-like 5 (CDKL5)	PF00069	29.185 (68/233)	2.56E-17
Apoptosis signal-regulating kinase 2 (MAP3K6)	PF19039 ; PF20309 ; PF20302 ; PF13281 ; PF00069 More >>	27.969 (73/261)	2.62E-17
Protein kinase C zeta (PRKCZ)	PF00130 ; PF00564 ; PF00069 ; PF00433 More >>	28.507 (63/221)	3.21E-17
MEK kinase kinase 3 (MAP4K3)	PF00780 ; PF00069	30.144 (63/209)	3.21E-17
Calcium/calmodulin-dependent protein kinase type IV (CAMK4)	PF00069	30.476 (64/210)	3.49E-17
Putative serine/threonine-protein kinase PRKY (PRKY)	PF00069	29.148 (65/223)	3.90E-17
MEK kinase kinase 1 (MAP4K1)	PF00780 ; PF00069	27.928 (62/222)	4.16E-17
Beta-adrenergic receptor kinase 1 (ADRBK1)	PF00169 ; PF00069 ; PF00615 More >>	26.316 (70/266)	4.28E-17
Nik-related protein kinase (NRK)	PF00780 ; PF00069	26.441 (78/295)	4.96E-17
Serine/threonine-protein kinase MAK (MAK)	PF00069	28.571 (86/301)	5.96E-17
Salt-inducible kinase 1 (SIK1)	PF00069	26.996 (71/263)	6.47E-17
Putative serine/threonine-protein kinase SIK1B (SIK1B)	PF00069	26.996 (71/263)	6.47E-17
Apoptosis signal-regulating kinase 1 (MAP3K5)	PF19039 ; PF20309 ; PF20302 ; PF13281 ; PF00069 More >>	27.165 (69/254)	7.45E-17
Cyclin-dependent kinase 15 (CDK15)	PF00069	30.189 (64/212)	7.83E-17
Calcium/calmodulin-dependent protein kinase type II subunit gamma (CAMK2G)	PF08332 ; PF00069	28.571 (60/210)	1.03E-16
Stress-activated protein kinase 2a (p38 alpha)	PF00069	30.986 (66/213)	1.22E-16
Serine/threonine-protein kinase Sgk2 (SGK2)	PF00069 ; PF00433	27.897 (65/233)	1.25E-16
Cyclin-dependent kinase 16 (CDK16)	PF12330 ; PF00069	31.527 (64/203)	1.27E-16
Myosin-IIIa (MYO3A)	PF00612 ; PF00063 ; PF00069 More >>	27.143 (76/280)	1.42E-16
Aurora kinase C (AURKC)	PF00069	29.557 (60/203)	1.44E-16
Serine/threonine-protein kinase H2 (PSKH2)	PF00069	30.189 (64/212)	1.46E-16
Cyclin-dependent kinase 2 (CDK2)	PF00069	31.132 (66/212)	1.60E-16
Calmodulin-dependent kinase II (CAMKK2)	PF00069	27.778 (60/216)	1.60E-16
Cytoplasmic DRAK1 (STK17A)	PF00069	35.185 (57/162)	1.66E-16
Death-associated protein kinase 1 (DAPK1)	PF00023 ; PF12796 ; PF13637 ; PF00531 ; PF00069 More >>	30.994 (53/171)	2.31E-16
Death-associated protein kinase 2 (DAPK2)	PF00069	29.825 (51/171)	2.38E-16
Serine/threonine-protein kinase MRCK gamma (CDC42BPG)	PF00130 ; PF00780 ; PF08826 ; PF00069 More >>	28.571 (78/273)	2.51E-16
Microtubule-associated serine/threonine-protein kinase 2 (MAST2)	PF08926 ; PF17820 ; PF00069 More >>	26.230 (64/244)	2.56E-16
Microtubule-associated serine/threonine-protein kinase 4 (MAST4)	PF08926 ; PF17820 ; PF02163 ; PF00069 More >>	25.632 (71/277)	2.78E-16
TGF-beta receptor type I (TGFBR1)	PF01064 ; PF00069 ; PF08515 More >>	32.589 (73/224)	3.61E-16
Serine/threonine-protein kinase H1 (PSKH1)	PF00069	30.000 (63/210)	4.24E-16
MAP kinase p38 (MAPK12)	PF00069	27.459 (67/244)	4.38E-16
Serine/threonine-protein kinase PLK3 (PLK3)	PF00069 ; PF00659	26.255 (68/259)	4.52E-16
Cyclin-dependent kinase 6 (CDK6)	PF00069	29.630 (64/216)	4.58E-16
Cyclin-dependent kinase 4 (CDK4)	PF00069	30.000 (63/210)	5.27E-16
Calcium/calmodulin-dependent protein kinase type 1 (CAMK1)	PF00069	30.097 (62/206)	5.96E-16
Protein kinase N3 (PKN3)	PF02185 ; PF00069 ; PF00433 More >>	29.130 (67/230)	6.70E-16
Serine/threonine-protein kinase NIM1 (NIM1K)	PF00069	27.907 (72/258)	7.07E-16
Ste-20-related kinase (STK39)	PF12202 ; PF00069	27.336 (79/289)	8.22E-16
Microtubule-associated serine/threonine-protein kinase 3 (MAST3)	PF08926 ; PF17820 ; PF02163 ; PF00069 More >>	27.004 (64/237)	9.69E-16
MEK kinase kinase 4 (MAP4K4)	PF00780 ; PF00069	28.378 (63/222)	1.06E-15
Peripheral plasma membrane protein CASK (CASK)	PF00625 ; PF02828 ; PF00595 ; PF00069 ; PF00018 More >>	32.569 (71/218)	1.18E-15
ERK activator kinase 2 (MEK2)	PF00069	28.395 (46/162)	1.18E-15
Oxidative stress responsive 1 (OXSR1)	PF12202 ; PF00069	25.436 (73/287)	1.35E-15
Testis-specific serine/threonine-protein kinase 6 (TSSK6)	PF00069	31.507 (69/219)	1.52E-15
Tyrosine-protein kinase EIF2AK2 (p68)	PF00035 ; PF00069	27.311 (65/238)	1.67E-15
Glycogen synthase kinase-3 beta (GSK-3B)	PF00069	29.915 (70/234)	1.77E-15
Cyclin-dependent kinase 14 (CDK14)	PF00069	32.127 (71/221)	2.09E-15
Serine/threonine-protein kinase tousled-like 2 (TLK2)	PF00069	29.767 (64/215)	2.38E-15
Calcium/calmodulin-dependent protein kinase type II subunit delta (CAMK2D)	PF08332 ; PF00069	29.224 (64/219)	2.61E-15
Serine/threonine-protein kinase 17B (STK17B)	PF00069	31.429 (55/175)	2.66E-15
Serine/threonine-protein kinase 32A (STK32A)	PF00069	28.507 (63/221)	3.36E-15
Microtubule-associated serine/threonine-protein kinase 1 (MAST1)	PF08926 ; PF17820 ; PF00069 More >>	26.667 (60/225)	3.49E-15
Serine/threonine-protein kinase ICK (CILK1)	PF00069	29.412 (60/204)	4.28E-15
Serine/threonine-protein kinase Chk2 (RAD53)	PF00498 ; PF00069	31.176 (53/170)	4.36E-15
NIMA-related kinase 2 (NEK2)	PF00069	25.683 (94/366)	4.51E-15
G protein-coupled receptor kinase 6 (GRK6)	PF00069 ; PF00615	30.233 (65/215)	6.41E-15
Serine/threonine-protein kinase SBK1 (SBK1)	PF00069	29.091 (64/220)	6.49E-15
Activin receptor type IB (ACVR1B)	PF01064 ; PF00069 ; PF08515 More >>	31.250 (70/224)	6.50E-15
Cyclin-dependent kinase 17 (CDK17)	PF12330 ; PF00069	31.220 (64/205)	6.65E-15
Serine/threonine-protein kinase tousled-like 1 (TLK1)	PF00069	29.439 (63/214)	8.36E-15
Cyclin-dependent kinase-like 3 (CDKL3)	PF00069	27.488 (58/211)	9.37E-15
Aurora kinase B (AURKB)	PF00069	26.482 (67/253)	1.12E-14
Cyclin-dependent kinase-like 1 (CDKL1)	PF00069	29.703 (60/202)	1.21E-14
Serine/threonine-protein kinase 35 (STK35)	PF00069	25.846 (84/325)	1.29E-14
Cyclin-dependent kinase 5 (CDK5)	PF00069	31.188 (63/202)	1.40E-14
Rho-associated protein kinase 2 (ROCK2)	PF00069 ; PF08912	26.471 (63/238)	1.91E-14
Mitogen-activated protein kinase 13 (MAPK13)	PF00069	28.972 (62/214)	1.91E-14
Cyclin-dependent kinase 18 (CDK18)	PF00069	31.034 (63/203)	1.98E-14
Rho-associated protein kinase 1 (ROCK1)	PF00069 ; PF08912	26.667 (72/270)	2.21E-14
TGF-beta-stimulated factor 1 (STK16)	PF00069	28.929 (81/280)	2.26E-14
Striated muscle preferentially expressed protein kinase (SPEG)	PF07679 ; PF00069 ; PF16650 More >>	28.293 (58/205)	2.38E-14
ERK activator kinase 1 (MEK1)	PF00069	26.601 (54/203)	2.39E-14
Putative 3-phosphoinositide-dependent protein kinase 2 (PDPK2P)	PF00069	25.792 (57/221)	2.64E-14
Polo-like kinase 1 (PLK1)	PF00069 ; PF00659	27.863 (73/262)	2.80E-14
Checkpoint kinase-1 (CHK1)	PF00069	29.954 (65/217)	3.48E-14
Serine/threonine-protein kinase PDIK1L (PDIK1L)	PF00069	24.051 (76/316)	3.56E-14
Phosphoinositide dependent protein kinase-1 (PDPK1)	PF14593 ; PF00069	25.339 (56/221)	3.86E-14
Doublecortin-like kinase 1 (DCLK1)	PF03607 ; PF00069	31.214 (54/173)	4.10E-14
Cyclin-dependent kinase-like 2 (CDKL2)	PF00069	28.922 (59/204)	5.19E-14
Cyclin-dependent kinase 19 (CDK19)	PF00069	30.698 (66/215)	6.04E-14
Testis-specific serine/threonine-protein kinase 3 (TSSK3)	PF00069	31.674 (70/221)	6.89E-14
Cyclin-dependent kinase 10 (CDK10)	PF00069	33.803 (72/213)	7.06E-14
Doublecortin-like kinase 2 (DCLK2)	PF03607 ; PF00069	28.505 (61/214)	8.70E-14
Cyclin-dependent kinase 11B (CDK11B)	PF00069	30.734 (67/218)	1.18E-13
G protein-coupled receptor kinase 5 (GRK5)	PF00069 ; PF00615	29.018 (65/224)	1.58E-13
Cyclin-dependent kinase 11A (CDK11A)	PF00069	30.734 (67/218)	1.60E-13
Inhibitor of nuclear factor kappa-B kinase alpha (IKKA)	PF18397 ; PF12179 ; PF00069 More >>	29.412 (65/221)	1.85E-13
SH3 domain-containing protein 21 (SH3D21)	PF07653	37.736 (40/106)	1.92E-13
Cyclin-dependent kinase 12 (CDK12)	PF00069	27.103 (58/214)	2.08E-13
Cyclin-dependent kinase 7 (CDK7)	PF00069	29.577 (63/213)	2.31E-13
Protein kinase G1 (PRKG1)	PF00027 ; PF16808 ; PF00069 More >>	25.581 (66/258)	2.58E-13
Cyclin-dependent kinase 13 (CDK13)	PF12330 ; PF00069	26.991 (61/226)	3.16E-13
Extracellular signal-regulated kinase 2 (ERK2)	PF00069	27.184 (56/206)	4.06E-13
Stress-activated protein kinase 2b (p38 beta)	PF00069	27.315 (59/216)	4.66E-13
Extracellular signal-regulated kinase 5 (ERK5)	PF00069	26.728 (58/217)	5.29E-13
G protein-coupled receptor kinase 4 (GRK4)	PF00069 ; PF00615	28.638 (61/213)	5.72E-13
Adaptor-associated kinase 1 (AAK1)	PF00069	24.382 (69/283)	6.04E-13
Serine/threonine-protein kinase greatwall (MASTL)	PF00069	31.034 (54/174)	6.15E-13
Testis-specific serine/threonine-protein kinase 4 (TSSK4)	PF00069	26.522 (61/230)	8.16E-13
Extracellular signal-regulated kinase 1 (ERK1)	PF00069	26.923 (56/208)	9.17E-13
Mitogen-activated protein kinase 15 (MAPK15)	PF00069	29.119 (76/261)	9.73E-13
Rhodopsin kinase GRK7 (GRK7)	PF00069 ; PF00615	27.189 (59/217)	1.00E-12
Citron Rho-interacting kinase (CIT)	PF00780 ; PF00169 ; PF00069 More >>	26.800 (67/250)	1.03E-12
Ribosomal protein S6 kinase-related protein (RSKR)	PF00069	27.751 (58/209)	1.12E-12
Yet another novel kinase 2 (STK32B)	PF00069	28.761 (65/226)	1.37E-12
Dual-specificity tyrosine-phosphorylation regulated kinase 1B (DYRK1B)	PF00069	26.697 (59/221)	1.44E-12
Stress-activated protein kinase JNK2 (JNK2)	PF00069	32.386 (57/176)	1.46E-12
Cyclin-dependent kinase 8 (CDK8)	PF00069	29.767 (64/215)	1.93E-12
CDC42 binding protein kinase alpha (DMPK-like alpha)	PF00130 ; PF00780 ; PF08826 ; PF15796 ; PF00069 ; PF00433 More >>	27.660 (65/235)	2.97E-12
Serine/threonine-protein kinase ULK4 (ULK4)	PF00069	24.232 (71/293)	3.13E-12
Serine/threonine-protein kinase LATS1 (LATS1)	PF00069 ; PF00627	24.275 (67/276)	5.42E-12
Serine/threonine-protein kinase 32C (STK32C)	PF00069	28.700 (64/223)	6.20E-12
Bone morphogenetic protein receptor (BMPR2)	PF01064 ; PF00069	26.744 (69/258)	9.89E-12
Dual specificity mitogen-activated protein kinase kinase 4 (MAP2K4)	PF00069	23.322 (66/283)	1.12E-11
Cyclin-dependent kinase-like 4 (CDKL4)	PF00069	28.358 (57/201)	1.18E-11
CaM kinase-like vesicle-associated protein (CAMKV)	PF00069	24.171 (51/211)	1.41E-11
Stress-activated protein kinase JNK1 (JNK1)	PF00069	26.708 (86/322)	1.54E-11
MAP kinase signal-integrating kinase 2 (MKNK2)	PF00069	27.928 (62/222)	2.74E-11
Serine/threonine-protein kinase NLK (NLK)	PF00069	28.837 (62/215)	3.01E-11
Myotonin-protein kinase (DMPK)	PF08826 ; PF00069	27.519 (71/258)	3.28E-11
Dual-specificity tyrosine-phosphorylation regulated kinase 1A (DYRK1A)	PF00069	27.064 (59/218)	3.41E-11
Titin (TTN)		22.831 (50/219)	4.30E-11
Stress-activated protein kinase JNK3 (JNK3)	PF00069	30.732 (63/205)	4.49E-11
Rhodopsin kinase GRK1 (GRK1)	PF00069 ; PF00615	27.547 (73/265)	4.95E-11
Anti-mullerian hormone II receptor (AMHR2)	PF00069	26.220 (86/328)	5.57E-11
Testis-specific serine/threonine-protein kinase 1 (TSSK1B)	PF00069	27.273 (48/176)	8.98E-11
Inhibitor of nuclear factor kappa-B kinase subunit epsilon (IKBKE)	PF00069 ; PF18394 ; PF18396 More >>	28.889 (65/225)	1.02E-10
MAPK-activated protein kinase 5 (MAPKAPK5)	PF00069	28.646 (55/192)	1.07E-10
Serine/threonine-protein kinase MRCK beta (CDC42BPB)	PF00130 ; PF00780 ; PF08826 ; PF15796 ; PF00069 More >>	28.151 (67/238)	1.07E-10
Serine/threonine-protein kinase NIK (MAP3K14)	PF00069	29.464 (66/224)	1.09E-10
Activin receptor type IIB (ACVR2B)	PF01064 ; PF00069	28.571 (66/231)	1.31E-10
Phosphorylase kinase testis gamma 2 (PHKG2)	PF00069	26.667 (60/225)	1.37E-10
NF-kappa-B-activating kinase (TBK1)	PF00069 ; PF18394 ; PF18396 More >>	27.679 (62/224)	2.10E-10
Dual specificity protein kinase TTK (MPS1)	PF00069	24.815 (67/270)	2.13E-10
Large tumor suppressor homolog 2 (LATS2)	PF00069 ; PF00433	24.000 (72/300)	2.25E-10
Homeodomain-interacting protein kinase 3 (HIPK3)	PF00069	28.846 (60/208)	2.30E-10
MAPK-activated protein kinase 3 (MAPKAPK3)	PF00069	24.490 (84/343)	2.31E-10
Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform (PHKG1)	PF00069	30.380 (48/158)	2.83E-10
Cyclin-G-associated kinase (GAK)	PF00069 ; PF10409	24.324 (81/333)	3.39E-10
Tau-tubulin kinase (TTBK1)	PF00069	22.291 (72/323)	4.02E-10
BMP-2-inducible protein kinase (BMP2K)	PF15282 ; PF00069	24.113 (68/282)	4.49E-10
Serine/threonine-protein kinase pim-2 (PIM2)	PF00069	25.177 (71/282)	7.29E-10
MAPK-activated protein kinase 2 (MAPKAPK2)	PF00069	25.871 (52/201)	7.94E-10
Dual specificity mitogen-activated protein kinase kinase 6 (MAP2K6)	PF00069	25.275 (46/182)	1.05E-09
Wee1-like protein kinase (WEE1)	PF00069	24.606 (78/317)	1.25E-09
Mitogen-activated protein kinase 4 (MAPK4)	PF00069	26.966 (48/178)	1.29E-09
Dual-specificity tyrosine-phosphorylation regulated kinase 3 (DYRK3)	PF00069	27.982 (61/218)	1.33E-09
Cyclin-dependent kinase 9 (CDK9)	PF00069	27.869 (51/183)	1.74E-09
Wee1-like protein kinase 2 (WEE2)	PF00069	23.741 (66/278)	1.89E-09
Testis-specific serine kinase 2 (TSSK2)	PF00069	24.277 (42/173)	2.01E-09
Activin receptor type IIA (ACVR2A)	PF01064 ; PF00069	29.565 (68/230)	2.06E-09
Dual specificity mitogen-activated protein kinase kinase 3 (MAP2K3)	PF00069	27.222 (49/180)	2.78E-09
MAPK/MAK/MRK overlapping kinase (MOK)	PF00069	25.943 (55/212)	4.36E-09
PIM-3 protein kinase (PIM3)	PF00069	29.583 (71/240)	4.72E-09
Cyclin-dependent kinase 20 (CDK20)	PF00069	27.586 (56/203)	5.11E-09
Homeodomain-interacting protein kinase 1 (HIPK1)	PF00069	27.149 (60/221)	5.73E-09
Homeodomain interacting protein kinase 2 (HIPK2)	PF00069	26.786 (60/224)	6.06E-09
Eukaryotic translation initiation factor 2-alpha kinase 1 (EIF2AK1)	PF00069	33.333 (41/123)	6.21E-09
Mitogen-activated protein kinase 6 (MAPK6)	PF00069	25.108 (58/231)	7.09E-09
Triple functional domain protein (TRIO)	PF00650 ; PF07679 ; PF00169 ; PF00069 ; PF00621 ; PF16609 ; PF00018 ; PF00435 More >>	25.660 (68/265)	8.19E-09
Interleukin-1 receptor-associated kinase-like 2 (IRAK2)	PF00531 ; PF00069	23.000 (46/200)	8.57E-09
Serine/threonine-protein kinase PRP4 homolog (PRPF4B)	PF00069	25.758 (68/264)	9.31E-09
NDR2 protein kinase (STK38L)	PF00069 ; PF00433	25.103 (61/243)	1.16E-08
Dual-specificity tyrosine-phosphorylation regulated kinase 2 (DYRK2)	PF00069	27.143 (57/210)	1.72E-08
Serine/threonine-protein kinase cot (COT)	PF00069	25.954 (68/262)	1.74E-08
Casein kinase I epsilon (CSNK1E)	PF00069	23.333 (70/300)	2.10E-08
PAS domain-containing serine/threonine-protein kinase (PASK)	PF13426 ; PF00069	25.347 (73/288)	2.18E-08
Serine/threonine-protein kinase pim-1 (PIM1)	PF00069	28.472 (41/144)	2.41E-08
Serine/threonine-protein kinase/endoribonuclease IRE2 (ERN2)	PF00069 ; PF06479	26.147 (57/218)	2.79E-08
CDC-like kinase 4 (CLK4)	PF00069	26.613 (66/248)	3.24E-08
CDC-like kinase 3 (CLK3)	PF00069	25.830 (70/271)	3.57E-08
PRKR-like endoplasmic reticulum kinase (PERK)	PF00069	29.379 (52/177)	4.03E-08
Casein kinase I delta (CSNK1D)	PF00069	23.906 (71/297)	4.07E-08
CDC-like kinase 1 (CLK1)	PF00069	27.917 (67/240)	6.57E-08
Guanine nucleotide exchange factor VAV2 (VAV2)	PF00130 ; PF11971 ; PF00169 ; PF00621 ; PF00017 ; PF07653 More >>	40.000 (28/70)	7.57E-08
Guanine nucleotide exchange factor VAV3 (VAV3)	PF00130 ; PF11971 ; PF00169 ; PF00621 ; PF00017 ; PF07653 More >>	40.000 (32/80)	1.09E-07
Growth factor receptor-bound protein 2 (GRB2)	PF00017 ; PF00018	42.593 (23/54)	1.27E-07
Dual-specificity tyrosine-phosphorylation regulated kinase 4 (DYRK4)	PF00069	25.118 (53/211)	1.78E-07
NDR1 protein kinase (STK38)	PF00069 ; PF00433	24.803 (63/254)	1.86E-07
Endophilin-A1 (SH3GL2)	PF03114 ; PF07653	35.526 (27/76)	2.04E-07
Proto-oncogene vav (VAV1)	PF00130 ; PF11971 ; PF00169 ; PF00621 ; PF00017 ; PF00018 More >>	38.806 (26/67)	4.63E-07
Tribbles homolog 2 (TRIB2)	PF00069	27.528 (49/178)	4.66E-07
Jouberin (AHI1)	PF00018 ; PF00400	40.678 (24/59)	5.07E-07
Kalirin (KALRN)	PF13716 ; PF00041 ; PF07679 ; PF00169 ; PF00069 ; PF00621 ; PF16609 ; PF00435 More >>	25.221 (57/226)	7.11E-07
Serine/threonine-protein kinase 40 (STK40)	PF00069	23.188 (48/207)	8.15E-07
Homeodomain-interacting protein kinase 4 (HIPK4)	PF00069	26.168 (56/214)	9.05E-07
Sugen kinase 110 (SBK3)	PF00069	27.329 (44/161)	1.06E-06
Serine/threonine-protein kinase SBK2 (SBK2)	PF00069	34.234 (38/111)	1.37E-06
STE20-related kinase adapter protein beta (STRADB)	PF00069	21.598 (73/338)	1.40E-06
Unconventional myosin-If (MYO1F)	PF00063 ; PF06017 ; PF00018 More >>	37.333 (28/75)	1.66E-06
Endoplasmic reticulum to nucleus signaling 1 (ERN1)	PF00069 ; PF06479	23.641 (87/368)	2.31E-06
CDC-like kinase 2 (CLK2)	PF00069	25.475 (67/263)	2.77E-06
Ribosomal protein S6 kinase delta-1 (RPS6KC1)	PF04212 ; PF00069 ; PF00787 More >>	29.697 (49/165)	2.92E-06
Casein kinase II alpha (CSNK2A1)	PF00069	22.727 (35/154)	3.48E-06
Endophilin-A3 (SH3GL3)	PF03114 ; PF00018	36.842 (21/57)	4.09E-06
Nuclear receptor-binding protein 2 (NRBP2)	PF00069	21.673 (57/263)	6.36E-06
Rho guanine nucleotide exchange factor 7 (ARHGEF7)	PF00307 ; PF00169 ; PF00621 ; PF16615 ; PF16614 ; PF07653 More >>	39.286 (22/56)	6.80E-06
GRB2-related adapter protein 2 (GRAP2)	PF00017 ; PF00018	40.741 (22/54)	7.20E-06
TBC domain-containing protein kinase-like protein (TBCK)	PF00069 ; PF00566 ; PF00581 More >>	26.667 (48/180)	7.38E-06
SH3 domain-containing YSC84-like protein 1 (SH3YL1)	PF00018 ; PF04366	40.000 (22/55)	9.36E-06
Eukaryotic translation initiation factor 2-alpha kinase 4 (EIF2AK4)	PF12745 ; PF00069 ; PF05773 ; PF13393 More >>	29.907 (32/107)	1.07E-05
Casein kinase II subunit alpha 3 (CSNK2A3)	PF00069	22.078 (34/154)	1.17E-05
Unconventional myosin-Ie (MYO1E)	PF00063 ; PF06017 ; PF00018 More >>	34.545 (19/55)	1.23E-05
Casein kinase I isoform alpha-like (CSNK1A1L)	PF00069	23.860 (68/285)	1.42E-05
Ribosomal protein S6 kinase-like 1 (RPS6KL1)	PF04212 ; PF00069	29.412 (45/153)	1.59E-05
MAPK signal-integrating kinase 1 (MKNK1)	PF00069	32.407 (35/108)	1.68E-05
Serine/threonine kinase-like domain-containing protein STKLD1 (STKLD1)	PF00069	29.412 (40/136)	1.73E-05
STE20-related kinase adapter protein alpha (STRADA)	PF00069	21.538 (42/195)	1.91E-05
Osteoclast-stimulating factor 1 (OSTF1)	PF12796 ; PF00018	36.842 (21/57)	2.05E-05
Endophilin-A2 (SH3GL1)	PF03114 ; PF00018	36.842 (21/57)	2.58E-05
Rho guanine nucleotide exchange factor 6 (ARHGEF6)	PF16523 ; PF00307 ; PF00169 ; PF00621 ; PF16615 ; PF16614 ; PF07653 More >>	36.066 (22/61)	2.94E-05
Hematopoietic lineage cell-specific protein (HCLS1)	PF02218 ; PF00018	40.741 (22/54)	3.82E-05
SH3 domain-containing protein 19 (SH3D19)	PF00018 ; PF07653	37.736 (20/53)	4.53E-05
GRB2-related adapter protein-like (GRAPL)	PF00017 ; PF00018	31.481 (17/54)	4.76E-05
Signal transducing adapter molecule 1 (STAM)	PF00018 ; PF02809 ; PF00790 More >>	33.333 (18/54)	6.75E-05
Src kinase-associated phosphoprotein 2 (SKAP2)	PF00169 ; PF00018	32.813 (21/64)	6.76E-05
Protein kinase C and casein kinase substrate in neurons protein 2 (PACSIN2)	PF00611 ; PF00018	38.889 (21/54)	8.88E-05
Breast cancer anti-estrogen resistance protein 1 (BCAR1)	PF12026 ; PF08824 ; PF00018 More >>	38.983 (23/59)	1.24E-04
Signal transducing adapter molecule 2 (STAM2)	PF00018 ; PF02809 ; PF00790 More >>	33.929 (19/56)	1.39E-04
GRB2-related adapter protein (GRAP)	PF00017 ; PF00018	41.509 (22/53)	2.47E-04
Tribbles homolog 1 (TRIB1)	PF00069	25.478 (40/157)	2.64E-04
Abl interactor 1 (ABI1)	PF07815 ; PF00018	33.803 (24/71)	2.68E-04
Casein kinase II alpha prime (CSNK2A2)	PF00069	23.148 (25/108)	4.88E-04
Neutrophil cytosol factor 2 (NCF2)	PF00564 ; PF00018 ; PF13181 More >>	39.623 (21/53)	5.66E-04
Click to Show/Hide the Information of Human Similarity Proteins

KEGG Pathway	Pathway ID	Affiliated Target	Pathway Map
MAPK signaling pathway	hsa04010	Affiliated Target
Class: Environmental Information Processing => Signal transduction	Pathway Hierarchy

Degree	9	Degree centrality	9.67E-04	Betweenness centrality	3.92E-04
Closeness centrality	2.35E-01	Radiality	1.41E+01	Clustering coefficient	1.94E-01
Neighborhood connectivity	4.70E+01	Topological coefficient	1.39E-01	Eccentricity	11
Download	Click to Download the Full PPI Network of This Target

Chemical Structure based Activity Landscape of Target

Top

Drug Property Profile of Target

Top

(1) Molecular Weight (mw) based Drug Clustering

(2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering

(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering

(4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering

(5) Rotatable Bond Count (rotbonds) based Drug Clustering

(6) Topological Polar Surface Area (polararea) based Drug Clustering

"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five

Target Poor or Non Binders

Top

Target Poor or Non Binders

Target Poor or Non Binders Info

Target Regulators

Top

Target-interacting Proteins

Target-interacting Proteins Info

Target Affiliated Biological Pathways

Top

KEGG Pathway

[+] 2 KEGG Pathways

MAPK signaling pathway

Non-alcoholic fatty liver disease (NAFLD)

Panther Pathway

[+] 1 Panther Pathways

CCKR signaling map ST

PID Pathway

[+] 4 PID Pathways

Reelin signaling pathway

CDC42 signaling events

IFN-gamma pathway

RAC1 signaling pathway

Target-Related Models and Studies

Top

Target Validation

Target Validation Info

References

Top

REF 1

Discovery, synthesis, and characterization of an orally bioavailable, brain penetrant inhibitor of mixed lineage kinase 3. J Med Chem. 2013 Oct 24;56(20):8032-48.

REF 2

Mixed-lineage kinase 1 and mixed-lineage kinase 3 subtype-selective dihydronaphthyl[3,4-a]pyrrolo[3,4-c]carbazole-5-ones: optimization, mixed-linea... J Med Chem. 2008 Sep 25;51(18):5680-9.

REF 3

Pharmacological inhibitors of MAPK pathways. Trends Pharmacol Sci. 2002 Jan;23(1):40-5.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.

Prof. Feng ZHU

Prof. Yuzong CHEN