Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T12097
(Former ID: TTDR00773)
|
|||||
Target Name |
Melanoma-associated antigen 4 (MAGEA4)
|
|||||
Synonyms |
MAGE4; MAGE-X2 antigen; MAGE-X2; MAGE-41 antigen; MAGE-41; MAGE-4 protein; MAGE-4 antigen; Cancer/testis antigen 1.4; CT1.4
Click to Show/Hide
|
|||||
Gene Name |
MAGEA4
|
|||||
Target Type |
Clinical trial target
|
[1] | ||||
Disease | [+] 4 Target-related Diseases | + | ||||
1 | Kaposi sarcoma [ICD-11: 2B57] | |||||
2 | Synovial sarcoma [ICD-11: 2B5A] | |||||
3 | Lung cancer [ICD-11: 2C25] | |||||
4 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||||
Function |
Not known, though may play a role in embryonal development and tumor transformation or aspects of tumor progression.
Click to Show/Hide
|
|||||
BioChemical Class |
Melanoma associated antigen
|
|||||
UniProt ID | ||||||
Sequence |
MSSEQKSQHCKPEEGVEAQEEALGLVGAQAPTTEEQEAAVSSSSPLVPGTLEEVPAAESA
GPPQSPQGASALPTTISFTCWRQPNEGSSSQEEEGPSTSPDAESLFREALSNKVDELAHF LLRKYRAKELVTKAEMLERVIKNYKRCFPVIFGKASESLKMIFGIDVKEVDPASNTYTLV TCLGLSYDGLLGNNQIFPKTGLLIIVLGTIAMEGDSASEEEIWEELGVMGVYDGREHTVY GEPRKLLTQDWVQENYLEYRQVPGSNPARYEFLWGPRALAETSYVKVLEHVVRVNARVRI AYPSLREAALLEEEEGV Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 3 Clinical Trial Drugs | + | ||||
1 | ADP-A2M4 | Drug Info | Phase 2 | Synovial sarcoma | [2] | |
2 | Afamitresgene autoleucel | Drug Info | Phase 2 | Soft tissue sarcoma | [3] | |
3 | CAR-T cells targeting MAGE-A4 | Drug Info | Phase 1/2 | Lung cancer | [1] | |
Mode of Action | [+] 1 Modes of Action | + | ||||
CAR-T-Cell-Therapy | [+] 1 CAR-T-Cell-Therapy drugs | + | ||||
1 | CAR-T cells targeting MAGE-A4 | Drug Info | [1] |
Cell-based Target Expression Variations | Top | |||||
---|---|---|---|---|---|---|
Cell-based Target Expression Variations |
Drug Binding Sites of Target | Top | |||||
---|---|---|---|---|---|---|
Ligand Name: 2-(2-{2-[2-(2-Methoxy-ethoxy)-ethoxy]-ethoxy}-ethoxy)-ethanol | Ligand Info | |||||
Structure Description | CRYSTAL STRUCTURE OF HLA-A*0201/MAGE-A4-PEPTIDE COMPLEX | PDB:1I4F | ||||
Method | X-ray diffraction | Resolution | 1.40 Å | Mutation | No | [5] |
PDB Sequence |
GVYDGREHTV
10
|
|||||
|
||||||
Click to View More Binding Site Information of This Target with Different Ligands |
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Tissue Distribution
of target is determined from a proteomics study that quantified more than 12,000 genes across 32 normal human tissues. Tissue Specificity (TS) score was used to define the enrichment of target across tissues.
The distribution of targets among different tissues or organs need to be taken into consideration when assessing the target druggability, as it is generally accepted that the wider the target distribution, the greater the concern over potential adverse effects
(Nat Rev Drug Discov, 20: 64-81, 2021).
Human Similarity Proteins
Human Tissue Distribution
|
Protein Name | Pfam ID | Percentage of Identity (%) | E value |
---|---|---|---|
Melanoma-associated antigen C2 (MAGEC2) | 50.000 (109/218) | 2.24E-60 | |
Melanoma-associated antigen C3 (MAGEC3) | 50.382 (66/131) | 6.40E-33 |
Note:
If a protein has TS (tissue specficity) scores at least in one tissue >= 2.5, this protein is called tissue-enriched (including tissue-enriched-but-not-specific and tissue-specific). In the plots, the vertical lines are at thresholds 2.5 and 4.
|
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-interacting Proteins |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | ClinicalTrials.gov (NCT03356808) Antigen-specific T Cells Against Lung Cancer | |||||
REF 2 | Clinical pipeline report, company report or official report of Adaptimmune. | |||||
REF 3 | ClinicalTrials.gov (NCT04044768) A Phase 2 Single Arm Open-Label Clinical Trial of ADP-A2M4 SPEAR? T Cells in Subjects With Advanced Synovial Sarcoma or Myxoid/Round Cell Liposarcoma. U.S.National Institutes of Health. | |||||
REF 4 | Autologous T cell therapy for MAGE-A4(+) solid cancers in HLA-A*02(+) patients: a phase 1 trial. Nat Med. 2023 Jan;29(1):104-114. | |||||
REF 5 | High-resolution structure of HLA-A*0201 in complex with a tumour-specific antigenic peptide encoded by the MAGE-A4 gene. J Mol Biol. 2001 Jul 27;310(5):1167-76. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.