Target Regulator(s) Information (Transcription Factor)
| Target General Information | Top | ||||
|---|---|---|---|---|---|
| Target ID | T76213 | Target Info | |||
| Target Name | Phenylalanine hydroxylase (PAH) | ||||
| Synonyms | Phenylalanine4hydroxylase; Phenylalanine-4-hydroxylase; Phe4monooxygenase; Phe-4-monooxygenase | ||||
| Target Type | Successful Target | ||||
| Gene Name | PAH | ||||
| Biochemical Class | Paired donor oxygen oxidoreductase | ||||
| UniProt ID | |||||
| The Transcription Factors (TFs) Regulating This Target | Top | ||||
|---|---|---|---|---|---|
| TF Name | Hepatocyte nuclear factor 1 (HNF1) homo/heterodimer | ||||
| Classification | Superclass | Helix-turn-helix | |||
| Class | Homeo domain | ||||
| Family | Homeo domain only | ||||
| Subfamily | Hepatocyte nuclear factor 1 | ||||
| Regulation Type | Increase | ||||
| Evidence Score (E-score) | 2 | + | |||
| 1 | Electrophoretic Mobility Shift Assay | [1] | |||
| 2 | Luciferase Reporter Assay | [2] | |||
| UniProt ID | |||||
| Sequence |
MVSKLSQLQTELLAALLESGLSKEALIQALGEPGPYLLAGEGPLDKGESCGGGRGELAEL
PNGLGETRGSEDETDDDGEDFTPPILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVK SYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHA GQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAE CIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFRHKLAMDTYSGPPPGPGPGPALP AHSSPGLPPPALSPSKVHGVRYGQPATSETAEVPSSSGGPLVTVSTPLHQVSPTGLEPSH SLLSTEAKLVSAAGGPLPPVSTLTALHSLEQTSPGLNQQPQNLIMASLPGVMTIGPGEPA SLGPTFTNTGASTLVIGLASTQAQSVPVINSMGSSLTTLQPVQFSQPLHPSYQQPLMPPV QSHVTQSPFMATMAQLQSPHALYSHKPEVAQYTHTGLLPQTMLITDTTNLSALASLTPTK QVFTSDTEASSESGLHTPASQATTLHVPSQDPAGIQHLQPAHRLSASPTVSSSSLVLYQS SDSSNGQSHLLPSNHSVIETFISTQMASSSQ |
||||
| The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
| Coagulation factors | [+] 1 Coagulation factors Co-regulated By This TF | + | |||
| 1 | Coagulation factor VIII (F8) | Successful Target | Target Info | [3] | |
| Oxidoreductases | [+] 1 Oxidoreductases Co-regulated By This TF | + | |||
| 1 | Phenylalanine hydroxylase (PAH) | Successful Target | Target Info | [1] | |
| Pentraxins | [+] 1 Pentraxins Co-regulated By This TF | + | |||
| 1 | CRP messenger RNA (CRP mRNA) | Clinical trial Target | Target Info | [4] | |
| References | Top | ||||
|---|---|---|---|---|---|
| REF 1 | Identification of thyroid hormone response elements in the human fatty acid synthase promoter. Proc Natl Acad Sci U S A. 1998 Oct 13;95(21):12260-5. | ||||
| REF 2 | Identification of hepatic nuclear factor 1 binding sites in the 5' flanking region of the human phenylalanine hydroxylase gene: implication of a du... Proc Natl Acad Sci U S A. 1998 Feb 17;95(4):1500-4. | ||||
| REF 3 | cis-acting elements and transcription factors involved in the promoter activity of the human factor VIII gene. J Biol Chem. 1995 May 19;270(20):11828-38. | ||||
| REF 4 | Regulation of human C-reactive protein gene expression by two synergistic IL-6 responsive elements. Biochemistry. 1996 Jul 16;35(28):9060-8. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.