Target Regulator(s) Information (Transcription Factor)
| Target General Information | Top | ||||
|---|---|---|---|---|---|
| Target ID | T64485 | Target Info | |||
| Target Name | Angiotensinogen (AGT) | ||||
| Synonyms | Serpin A8; SERPINA8 | ||||
| Target Type | Literature-reported Target | ||||
| Gene Name | AGT | ||||
| Biochemical Class | Serpin protein | ||||
| UniProt ID | |||||
| The Transcription Factors (TFs) Regulating This Target | Top | ||||
|---|---|---|---|---|---|
| TF Name | C/EBP delta (CEBPD) homodimer | ||||
| Classification | Superclass | Basic Domains | |||
| Class | Leucine zipper factors (bZIP) | ||||
| Family | C/EBP-like factors | ||||
| Regulation Type | Increase | ||||
| Regulation Mechanism | C/EBP-delta binds to the proximalpromoterand regulates liver-specific expression of the humanAGTgene. | [1] | |||
| Evidence Score (E-score) | 2 | + | |||
| 1 | Electrophoretic Mobility Shift Assay | [1] | |||
| 2 | Reporter Assay | [4] | |||
| UniProt ID | |||||
| Sequence |
MSAALFSLDGPARGAPWPAEPAPFYEPGRAGKPGRGAEPGALGEPGAAAPAMYDDESAID
FSAYIDSMAAVPTLELCHDELFADLFNSNHKAGGAGPLELLPGGPARPLGPGPAAPRLLK REPDWGDGDAPGSLLPAQVAACAQTVVSLAAAGQPTPPTSPEPPRSSPRQTPAPGPAREK SAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQL TRDLAGLRQFFKQLPSPPFLPAAGTADCR |
||||
| The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
| Apolipoproteins | [+] 1 Apolipoproteins Co-regulated By This TF | + | |||
| 1 | Apolipoprotein B-100 (APOB) | Clinical trial Target | Target Info | [5] | |
| Lipoprotein receptors | [+] 1 Lipoprotein receptors Co-regulated By This TF | + | |||
| 1 | Low-density lipoprotein receptor (LDL-R) | Successful Target | Target Info | [6] | |
| Pentraxins | [+] 1 Pentraxins Co-regulated By This TF | + | |||
| 1 | CRP messenger RNA (CRP mRNA) | Clinical trial Target | Target Info | [7] | |
| Serpin proteins | [+] 1 Serpin proteins Co-regulated By This TF | + | |||
| 1 | Angiotensinogen (AGT) | Literature-reported Target | Target Info | [1] | |
| Somatotropin / Prolactins | [+] 1 Somatotropin / Prolactins Co-regulated By This TF | + | |||
| 1 | Prolactin (PRL) | Discontinued Target | Target Info | [8] | |
| Transferrins | [+] 1 Transferrins Co-regulated By This TF | + | |||
| 1 | Transferrin (TF) | Clinical trial Target | Target Info | [9] | |
| TF Name | Hepatocyte nuclear factor 4-alpha (HNF-4A) homodimer | ||||
| Classification | Superclass | Zinc-coordinating DNA-binding domains | |||
| Class | Cys4 zinc finger of nuclear receptor type | ||||
| Family | Thyroid hormone receptor-like factors | ||||
| Subfamily | Hepatocyte nuclear factor 4 | ||||
| Regulation Type | Increase | ||||
| Regulation Mechanism | HNF4 binds to the promoter elements and strongly activated the AGT transcription. | [2] | |||
| Evidence Score (E-score) | 1 | + | |||
| 1 | Electrophoretic Mobility Shift Assay | [2] | |||
| UniProt ID | |||||
| Sequence |
MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNAPNSLGVSALC
AICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKC FRAGMKKEAVQNERDRISTRRSSYEDSSLPSINALLQAEVLSRQITSPVSGINGDIRAKK IASIADVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMVFK DVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYAYLKAIIFFDPDAK GLSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKL FGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEW PRPRGQAATPETPQPSPPGGSGSEPYKLLPGAVATIVKPLSAIPQPTITKQEVI |
||||
| The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
| Apolipoproteins | [+] 4 Apolipoproteins Co-regulated By This TF | + | |||
| 1 | Apolipoprotein A-I (APOA1) | Clinical trial Target | Target Info | [10] | |
| 2 | Apolipoprotein A-II (APOA2) | Literature-reported Target | Target Info | [11] | |
| 3 | Apolipoprotein B-100 (APOB) | Clinical trial Target | Target Info | [12] | |
| 4 | Apolipoprotein C-III (ApoCIII) | Clinical trial Target | Target Info | [13] | |
| Coagulation factors | [+] 1 Coagulation factors Co-regulated By This TF | + | |||
| 1 | Coagulation factor VIII (F8) | Successful Target | Target Info | [14] | |
| Hormones | [+] 1 Hormones Co-regulated By This TF | + | |||
| 1 | Erythropoietin (EPO) | Clinical trial Target | Target Info | [15] | |
| Nuclear hormone receptors | [+] 1 Nuclear hormone receptors Co-regulated By This TF | + | |||
| 1 | Hepatocyte nuclear factor 4-alpha (HNF4A) | Literature-reported Target | Target Info | [16] | |
| Oxidoreductases | [+] 2 Oxidoreductases Co-regulated By This TF | + | |||
| 1 | Debrisoquine 4-hydroxylase (CYP2D6) | Successful Target | Target Info | [17] | |
| 2 | Heme oxygenase 1 (HMOX1) | Clinical trial Target | Target Info | [18] | |
| Peptidases | [+] 1 Peptidases Co-regulated By This TF | + | |||
| 1 | Coagulation factor IX (F9) | Successful Target | Target Info | [19] | |
| Serpin proteins | [+] 1 Serpin proteins Co-regulated By This TF | + | |||
| 1 | Angiotensinogen (AGT) | Literature-reported Target | Target Info | [2] | |
| Transferrins | [+] 1 Transferrins Co-regulated By This TF | + | |||
| 1 | Transferrin (TF) | Clinical trial Target | Target Info | [9] | |
| TF Name | Upstream stimulatory factor 1 (USF1) homodimer | ||||
| Classification | Superclass | Basic Domains | |||
| Class | Helix-loop-helix / leucine zipper factors (bHLH-ZIP) | ||||
| Family | Upstream stimulatory factor | ||||
| Regulation Type | Increase | ||||
| Regulation Mechanism | A ubiquitously expressed nuclear factor, AGCF1, bound to AGCE1 (AG core promoter element 1 including the core nucleotides, CTCGTG, CTC-type) located between the TATA box and transcription initiation site (positions -25 to -1) is an authentic regulator of human AG transcription. The possible involvement of USF1 as a component in AGCF1 formation and the potential importance of AGCE1 variation in blood pressure regulation through human AG expression. | [3] | |||
| Evidence Score (E-score) | 1 | + | |||
| 1 | Electrophoretic Mobility Shift Assay | [3] | |||
| UniProt ID | |||||
| Sequence |
MKGQQKTAETEEGTVQIQEGAVATGEDPTSVAIASIQSAATFPDPNVKYVFRTENGGQVM
YRVIQVSEGQLDGQTEGTGAISGYPATQSMTQAVIQGAFTSDDAVDTEGTAAETHYTYFP STAVGDGAGGTTSGSTAAVVTTQGSEALLGQATPPGTGQFFVMMSPQEVLQGGSQRSIAP RTHPYSPKSEAPRTTRDEKRRAQHNEVERRRRDKINNWIVQLSKIIPDCSMESTKSGQSK GGILSKACDYIQELRQSNHRLSEELQGLDQLQLDNDVLRQQVEDLKNKNLLLRAQLRHHG LEVVIKNDSN |
||||
| The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
| Apolipoproteins | [+] 1 Apolipoproteins Co-regulated By This TF | + | |||
| 1 | Apolipoprotein C-III (ApoCIII) | Clinical trial Target | Target Info | [20] | |
| Cyclins | [+] 1 Cyclins Co-regulated By This TF | + | |||
| 1 | G2/mitotic-specific cyclin B1 (CCNB1) | Patented-recorded Target | Target Info | [21] | |
| Oxidoreductases | [+] 1 Oxidoreductases Co-regulated By This TF | + | |||
| 1 | Heme oxygenase 1 (HMOX1) | Clinical trial Target | Target Info | [22] | |
| Serpin proteins | [+] 1 Serpin proteins Co-regulated By This TF | + | |||
| 1 | Angiotensinogen (AGT) | Literature-reported Target | Target Info | [3] | |
| TF Name | COUP transcription factor (COUP-TF) homo/heterodimer | ||||
| Classification | Superclass | Zinc-coordinating DNA-binding domains | |||
| Class | Cys4 zinc finger of nuclear receptor type | ||||
| Regulation Type | Decrease | ||||
| Regulation Mechanism | COUP-TF, a transcriptional repressor, dramatically represses AGT transcription through the promoter elements and the downstream enhancer core elements. | [2] | |||
| Evidence Score (E-score) | 1 | + | |||
| 1 | Electrophoretic Mobility Shift Assay | [2] | |||
| UniProt ID | |||||
| Sequence |
MAMVVSSWRDPQDDVAGGNPGGPNPAAQAARGGGGGAGEQQQQAGSGAPHTPQTPGQPGA
PATPGTAGDKGQGPPGSGQSQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTY TCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLN GHCYLSGYISLLLRAEPYPTSRYGSQCMQPNNIMGIENICELAARLLFSAVEWARNIPFF PDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIR IFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQY PNQPSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMSI QCS |
||||
| The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
| Nuclear hormone receptors | [+] 1 Nuclear hormone receptors Co-regulated By This TF | + | |||
| 1 | Retinoic acid receptor RXR-gamma (RXRG) | Successful Target | Target Info | [23] | |
| Oxidoreductases | [+] 1 Oxidoreductases Co-regulated By This TF | + | |||
| 1 | Debrisoquine 4-hydroxylase (CYP2D6) | Successful Target | Target Info | [17] | |
| Serpin proteins | [+] 1 Serpin proteins Co-regulated By This TF | + | |||
| 1 | Angiotensinogen (AGT) | Literature-reported Target | Target Info | [2] | |
| Transferrins | [+] 1 Transferrins Co-regulated By This TF | + | |||
| 1 | Transferrin (TF) | Clinical trial Target | Target Info | [24] | |
| References | Top | ||||
|---|---|---|---|---|---|
| REF 1 | DBP binds to the proximal promoter and regulates liver-specific expression of the human angiotensinogen gene. Biochem Biophys Res Commun. 1998 Oct 9;251(1):388-93. | ||||
| REF 2 | Regulated expression of human angiotensinogen gene by hepatocyte nuclear factor 4 and chicken ovalbumin upstream promoter-transcription factor. J Biol Chem. 1999 Dec 3;274(49):34605-12. | ||||
| REF 3 | Molecular variation of the human angiotensinogen core promoter element located between the TATA box and transcription initiation site affects its transcriptional activity. J Biol Chem. 1997 Nov 28;272(48):30558-62. | ||||
| REF 4 | A single-nucleotide polymorphism in human angiotensinogen gene is associated with essential hypertension and affects glucocorticoid induced promote... J Mol Med (Berl). 2005 Feb;83(2):121-31. | ||||
| REF 5 | Members of the caudal family of homeodomain proteins repress transcription from the human apolipoprotein B promoter in intestinal cells. J Biol Chem. 1996 Jan 12;271(2):707-18. | ||||
| REF 6 | Identification of a novel sterol-independent regulatory element in the human low density lipoprotein receptor promoter. J Biol Chem. 2000 Feb 18;275(7):5214-21. | ||||
| REF 7 | The two C/EBP isoforms, IL-6DBP/NF-IL6 and C/EBP delta/NF-IL6 beta, are induced by IL-6 to promote acute phase gene transcription via different mechanisms. Nucleic Acids Res. 1993 Jan 25;21(2):289-94. | ||||
| REF 8 | CCAAT/enhancer-binding proteins are mediators in the protein kinase A-dependent activation of the decidual prolactin promoter. J Biol Chem. 1999 Aug 27;274(35):24808-18. | ||||
| REF 9 | A different combination of transcription factors modulates the expression of the human transferrin promoter in liver and Sertoli cells. J Biol Chem. 1993 Nov 5;268(31):23399-408. | ||||
| REF 10 | Modulation of transcriptional activation and coactivator interaction by a splicing variation in the F domain of nuclear receptor hepatocyte nuclear factor 4alpha1. Mol Cell Biol. 1999 Oct;19(10):6509-22. | ||||
| REF 11 | Transcriptional regulation of human apolipoprotein genes ApoB, ApoCIII, and ApoAII by members of the steroid hormone receptor superfamily HNF-4, AR... J Biol Chem. 1992 Aug 5;267(22):15849-60. | ||||
| REF 12 | Identification and characterization of a 315-base pair enhancer, located more than 55 kilobases 5' of the apolipoprotein B gene, that confers expression in the intestine. J Biol Chem. 2000 Aug 25;275(34):26637-48. | ||||
| REF 13 | Mitogen-activated protein kinase regulates transcription of the ApoCIII gene. Involvement of the orphan nuclear receptor HNF4. J Biol Chem. 1999 Nov 12;274(46):33050-6. | ||||
| REF 14 | cis-acting elements and transcription factors involved in the promoter activity of the human factor VIII gene. J Biol Chem. 1995 May 19;270(20):11828-38. | ||||
| REF 15 | The orphan receptor hepatic nuclear factor 4 functions as a transcriptional activator for tissue-specific and hypoxia-specific erythropoietin gene expression and is antagonized by EAR3/COUP-TF1. Mol Cell Biol. 1995 Apr;15(4):2135-44. | ||||
| REF 16 | Regulatory mechanisms controlling human hepatocyte nuclear factor 4alpha gene expression. Mol Cell Biol. 2001 Nov;21(21):7320-30. | ||||
| REF 17 | Characterization of the human cytochrome P4502D6 promoter. A potential role for antagonistic interactions between members of the nuclear receptor family. J Biol Chem. 1996 Oct 11;271(41):25269-76. | ||||
| REF 18 | Co-operation of the transcription factor hepatocyte nuclear factor-4 with Sp1 or Sp3 leads to transcriptional activation of the human haem oxygenase-1 gene promoter in a hepatoma cell line. Biochem J. 2002 Nov 1;367(Pt 3):641-52. | ||||
| REF 19 | Disruption of a C/EBP binding site in the factor IX promoter is associated with haemophilia B. Nature. 1990 May 31;345(6274):444-6. | ||||
| REF 20 | Two initiator-like elements are required for the combined activation of the human apolipoprotein C-III promoter by upstream stimulatory factor and ... J Biol Chem. 2002 Apr 26;277(17):15199-206. | ||||
| REF 21 | Upstream stimulatory factor regulates expression of the cell cycle-dependent cyclin B1 gene promoter. Mol Cell Biol. 1995 May;15(5):2782-90. | ||||
| REF 22 | Interaction of upstream stimulatory factor with the human heme oxygenase gene promoter. Eur J Biochem. 1990 Mar 10;188(2):231-7. | ||||
| REF 23 | Identification of thyroid hormone response elements in the human fatty acid synthase promoter. Proc Natl Acad Sci U S A. 1998 Oct 13;95(21):12260-5. | ||||
| REF 24 | Brain-specific expression of the human transferrin gene. Similar elements govern transcription in oligodendrocytes and in a neuronal cell line. J Biol Chem. 1994 Sep 30;269(39):24504-10. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.