Target Regulator(s) Information (Transcription Factor)
| Target General Information | Top | ||||
|---|---|---|---|---|---|
| Target ID | T26144 | Target Info | |||
| Target Name | Fibrinogen (FGG) | ||||
| Synonyms | PRO2061; Fibrinogen gamma chain | ||||
| Target Type | Literature-reported Target | ||||
| Gene Name | FGG | ||||
| Biochemical Class | Fibrinogen protein | ||||
| UniProt ID | |||||
| The Transcription Factors (TFs) Regulating This Target | Top | ||||
|---|---|---|---|---|---|
| TF Name | Signal transducer and activator of transcription 3 (STAT3) homodimer | ||||
| Classification | Superclass | beta-Scaffold Factors with Minor Groove Contacts | |||
| Class | Signal transducer and activator of transcription | ||||
| Family | Signal transducer and activator of transcription | ||||
| Regulation Type | Increase | ||||
| Regulation Mechanism | STAT3 transactivation via IL-6REs on FGG promoters likely involves participation of additional transcription factors and/or coactivators to achieve optimal coordinated up-regulation during an APR. | [1] | |||
| Evidence Score (E-score) | 2 | + | |||
| 1 | Electrophoretic Mobility Shift Assay | [3] | |||
| 2 | Luciferase Reporter Assay, Electrophoretic Mobility Shift Assay | [1] | |||
| UniProt ID | |||||
| Sequence |
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST KPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSN TIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM |
||||
| The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
| Cytokines / Cytokine receptors | [+] 1 Cytokines / Cytokine receptors Co-regulated By This TF | + | |||
| 1 | Interleukin 2 receptor alpha (IL2RA) | Successful Target | Target Info | [4] | |
| Fibrinogen proteins | [+] 1 Fibrinogen proteins Co-regulated By This TF | + | |||
| 1 | Fibrinogen (FGG) | Literature-reported Target | Target Info | [1] | |
| TF Name | Upstream stimulatory factor (USF) homo/heterodimer | ||||
| Classification | Superclass | Basic Domains | |||
| Class | Helix-loop-helix / leucine zipper factors (bHLH-ZIP) | ||||
| Family | upstream stimulatory factor | ||||
| Regulation Type | Increase | ||||
| Regulation Mechanism | Reporter gene studies using chloramphenicol acetyltransferase as the indicator along with mutations in the DNA showed that a USF binding site (-66 to -77 bp) constitute a minimal promoter that mediates liver-specific expression of the FGG gene. | [2] | |||
| Evidence Score (E-score) | 1 | + | |||
| 1 | Electrophoretic Mobility Shift Assay | [2] | |||
| UniProt ID | |||||
| Sequence |
MKGQQKTAETEEGTVQIQEGAVATGEDPTSVAIASIQSAATFPDPNVKYVFRTENGGQVM
YRVIQVSEGQLDGQTEGTGAISGYPATQSMTQAVIQGAFTSDDAVDTEGTAAETHYTYFP STAVGDGAGGTTSGSTAAVVTTQGSEALLGQATPPGTGQFFVMMSPQEVLQGGSQRSIAP RTHPYSPKSEAPRTTRDEKRRAQHNEVERRRRDKINNWIVQLSKIIPDCSMESTKSGQSK GGILSKACDYIQELRQSNHRLSEELQGLDQLQLDNDVLRQQVEDLKNKNLLLRAQLRHHG LEVVIKNDSN |
||||
| The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
| Cytokines / Cytokine receptors | [+] 1 Cytokines / Cytokine receptors Co-regulated By This TF | + | |||
| 1 | Interferon-gamma (IFNG) | Successful Target | Target Info | [5] | |
| Fibrinogen proteins | [+] 1 Fibrinogen proteins Co-regulated By This TF | + | |||
| 1 | Fibrinogen (FGG) | Literature-reported Target | Target Info | [2] | |
| Peptidases | [+] 1 Peptidases Co-regulated By This TF | + | |||
| 1 | Cathepsin D (CTSD) | Clinical trial Target | Target Info | [6] | |
| References | Top | ||||
|---|---|---|---|---|---|
| REF 1 | Functional analysis of interleukin 6 response elements (IL-6REs) on the human gamma-fibrinogen promoter: binding of hepatic Stat3 correlates negatively with transactivation potential of type II IL-6REs. J Biol Chem. 2003 Oct 17;278(42):41270-81. | ||||
| REF 2 | Characterization of the 5'-flanking region of the gene for the gamma chain of human fibrinogen. J Biol Chem. 1995 Nov 24;270(47):28350-6. | ||||
| REF 3 | Characterization of the IL-6 responsive elements in the gamma fibrinogen gene promoter. J Biol Chem. 1995 Oct 13;270(41):24287-91. | ||||
| REF 4 | Interferon-alpha activates multiple STAT proteins and upregulates proliferation-associated IL-2Ralpha, c-myc, and pim-1 genes in human T cells. Blood. 1999 Mar 15;93(6):1980-91. | ||||
| REF 5 | Retinoic acid-induced transcriptional modulation of the human interferon-gamma promoter. J Biol Chem. 1996 Oct 25;271(43):26783-93. | ||||
| REF 6 | Upstream stimulatory factors mediate estrogen receptor activation of the cathepsin D promoter. Mol Endocrinol. 1998 Sep;12(9):1310-21. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.