Target Regulator(s) Information (Transcription Factor)

Content Navigation (  All   None )                                      
Target General Information
The Transcription Factors (TFs) Regulating This Target
References
Target General Information  Top
Target ID T25076 Target Info
Target Name Endothelin-1 (EDN1)
Synonyms Preproendothelin-1; PPET1
Target Type Literature-reported Target
Gene Name EDN1
Biochemical Class Endothelin/sarafotoxin
UniProt ID
EDN1_HUMAN
The Transcription Factors (TFs) Regulating This Target  Top
TF Name GATA-binding factor 2 (GATA-2)
Classification Superclass Zinc-coordinating DNA-binding domains
Class diverse Cys4 zinc fingers
Family GATA-Factors
Subfamily vertebral GATA-Factors
Regulation Mechanism Binding studies in vitro confirmed physical associations amongGATA-2, AP-1, and HIF-1 factors. Overexpression or depletion of p300/CBP modulated the level ofEDN1promoterexpression as well as the endogenous EDN1transcript but did not change the fold induction by hypoxia in either case. [1]
Evidence Score (E-score) 2 +
1 Electrophoretic Mobility Shift Assay [2]
2 Electrophoretic Mobility Shift Assay, Pull-Down Assay [1]
UniProt ID
GATA2_HUMAN
Sequence
MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYY
ANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSP
FSKTPLHPSAAGGPGGPLSVYPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKE
VSPDPSTTGAASPASSSAGGSAARGEDKDGVKYQVSLTESMKMESGSPLRPGLATMGTQP
ATHHPIPTYPSYVPAAAHDYSSGLFHPGGFLGGPASSFTPKQRSKARSCSEGRECVNCGA
TATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLW
RRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKMSNKSKKSKKGAECFEELSKC
MQEKSSPFSAAALAGHMAPVGHLPPFSHSGHILPTPTPIHPSSSLSFGHPHPSSMVTAMG
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Endothelins/sarafotoxins [+] 1 Endothelins/sarafotoxins Co-regulated By This TF +
1 Endothelin-1 (EDN1) Literature-reported Target Target Info [1]
G protein-coupled receptors [+] 1 G protein-coupled receptors Co-regulated By This TF +
1 Gonadotropin-releasing hormone receptor (GNRHR) Successful Target Target Info [3]
Glycoproteins [+] 1 Glycoproteins Co-regulated By This TF +
1 von Willebrand factor (VWF) Successful Target Target Info [4]
Hormones [+] 1 Hormones Co-regulated By This TF +
1 Erythropoietin (EPO) Clinical trial Target Target Info [5]
Oxidoreductases [+] 2 Oxidoreductases Co-regulated By This TF +
1 Estradiol 17 beta-dehydrogenase 1 (17-beta-HSD1) Clinical trial Target Target Info [6]
2 Nitric-oxide synthase endothelial (NOS3) Clinical trial Target Target Info [7]
Transcription factors [+] 1 Transcription factors Co-regulated By This TF +
1 Wilms tumor protein (WT1) Clinical trial Target Target Info [8]
TF Name c-Jun/c-Fos (AP-1) heterodimer
Classification Superclass Basic Domains
Class Leucine zipper factors (bZIP)
Family AP-1(-like) components
Regulation Mechanism Binding studies in vitro confirmed physical associations amongGATA-2, AP-1, and HIF-1 factors. Overexpression or depletion of p300/CBP modulated the level ofEDN1promoterexpression as well as the endogenous EDN1transcript but did not change the fold induction by hypoxia in either case. [1]
Evidence Score (E-score) 1 +
1 Electrophoretic Mobility Shift Assay, Pull-Down Assay [1]
UniProt ID
JUN_HUMAN/FOS_HUMAN
Sequence
MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA
LSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETP
PLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANM
LREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Acyltransferases [+] 1 Acyltransferases Co-regulated By This TF +
1 Glutathione S-transferase P (GSTP1) Clinical trial Target Target Info [9]
Cytokines / Cytokine receptors [+] 1 Cytokines / Cytokine receptors Co-regulated By This TF +
1 Interferon-gamma (IFNG) Successful Target Target Info [10]
Endothelins/sarafotoxins [+] 1 Endothelins/sarafotoxins Co-regulated By This TF +
1 Endothelin-1 (EDN1) Literature-reported Target Target Info [1]
G protein-coupled receptors [+] 1 G protein-coupled receptors Co-regulated By This TF +
1 Gonadotropin-releasing hormone receptor (GNRHR) Successful Target Target Info [3]
Glucagons [+] 1 Glucagons Co-regulated By This TF +
1 Vasoactive intestinal polypeptide (VIP) Literature-reported Target Target Info [11]
Hormones [+] 1 Hormones Co-regulated By This TF +
1 Corticoliberin (CRH) Literature-reported Target Target Info [12]
Integrins [+] 1 Integrins Co-regulated By This TF +
1 Integrin alpha-2 (ITGA2) Clinical trial Target Target Info [13]
Oxidoreductases [+] 1 Oxidoreductases Co-regulated By This TF +
1 Quinone reductase 1 (NQO1) Clinical trial Target Target Info [14]
Peptidases [+] 1 Peptidases Co-regulated By This TF +
1 Urokinase-type plasminogen activator (PLAU) Successful Target Target Info [15]
Somatotropin / Prolactins [+] 1 Somatotropin / Prolactins Co-regulated By This TF +
1 Prolactin (PRL) Discontinued Target Target Info [16]
Transcription factors [+] 2 Transcription factors Co-regulated By This TF +
1 Cellular tumor antigen p53 (TP53) Clinical trial Target Target Info [17]
2 Transcription factor AP-1 (JUN) Discontinued Target Target Info [18]
TF Name Hypoxia-inducible factor 1A/1B (HIF-1) heterodimer
Classification Superclass Basic Domains
Class Tal/Twist/Atonal/Hen
Family Factors with PAS domain
Regulation Mechanism There is a preliminary characterization of a HIF-1 binding site in the human END1 promoter which contributed to the activation of END1 expression in endothelial cells. [1]
Evidence Score (E-score) 1 +
1 Electrophoretic Mobility Shift Assay, Pull-Down Assay [1]
UniProt ID
HIF1A_HUMAN/ARNT_HUMAN
Sequence
MEGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVM
RLTISYLRVRKLLDAGDLDIEDDMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKYM
GLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGLVKKGKEQNTQRSFFLRMKCTLTSRGR
TMNIKSATWKVLHCTGHIHVYDTNSNQPQCGYKKPPMTCLVLICEPIPHPSNIEIPLDSK
TFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQV
TTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTECV
LKPVESSDMKMTQLFTKVESEDTSSLFDKLKKEPDALTLLAPAAGDTIISLDFGSNDTET
DDQQLEEVPLYNDVMLPSPNEKLQNINLAMSPLPTAETPKPLRSSADPALNQEVALKLEP
NPESLELSFTMPQIQDQTPSPSDGSTRQSSPEPNSPSEYCFYVDSDMVNEFKLELVEKLF
AEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESSSASPESASPQSTVT
VFQQTQIQEPTANATTTTATTDELKTVTKDRMEDIKILIASPSPTHIHKETTSATSSPYR
DTQSRTASPNRAGKGVIEQTEKSHPRSPNVLSVALSQRTTVPEEELNPKILALQNAQRKR
KMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLAC
RLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Endothelins/sarafotoxins [+] 1 Endothelins/sarafotoxins Co-regulated By This TF +
1 Endothelin-1 (EDN1) Literature-reported Target Target Info [1]
Growth factors [+] 1 Growth factors Co-regulated By This TF +
1 Vascular endothelial growth factor A (VEGFA) Successful Target Target Info [19]
Hormones [+] 1 Hormones Co-regulated By This TF +
1 Erythropoietin (EPO) Clinical trial Target Target Info [20]
Peptidases [+] 1 Peptidases Co-regulated By This TF +
1 Transferrin receptor protein 1 (TFRC) Clinical trial Target Target Info [21]
References  Top
REF 1 Molecular regulation of the endothelin-1 gene by hypoxia. Contributions of hypoxia-inducible factor-1, activator protein-1, GATA-2, AND p300/CBP. J Biol Chem. 2001 Apr 20;276(16):12645-53.
REF 2 Cooperative interaction of GATA-2 and AP1 regulates transcription of the endothelin-1 gene. Mol Cell Biol. 1995 Aug;15(8):4225-31.
REF 3 Functional mapping of a placenta-specific upstream promoter for human gonadotropin-releasing hormone receptor gene. Endocrinology. 2001 Apr;142(4):1506-16.
REF 4 Endothelial-cell-specific regulation of von Willebrand factor gene expression. Mol Cell Biol. 1994 Feb;14(2):999-1008.
REF 5 N(G)-monomethyl-L-arginine inhibits erythropoietin gene expression by stimulating GATA-2. Blood. 2000 Sep 1;96(5):1716-22.
REF 6 The proximal promoter region of the gene encoding human 17beta-hydroxysteroid dehydrogenase type 1 contains GATA, AP-2, and Sp1 response elements: analysis of promoter function in choriocarcinoma cells. Endocrinology. 1997 Aug;138(8):3417-25.
REF 7 Functional analysis of the human endothelial nitric oxide synthase promoter. Sp1 and GATA factors are necessary for basal transcription in endothelial cells. J Biol Chem. 1995 Jun 23;270(25):15320-6.
REF 8 Transactivation of an intronic hematopoietic-specific enhancer of the human Wilms' tumor 1 gene by GATA-1 and c-Myb. J Biol Chem. 1997 Nov 14;272(46):29272-80.
REF 9 Involvement of Jun and Fos proteins in regulating transcriptional activation of the human pi class glutathione S-transferase gene in multidrug-resi... J Biol Chem. 1994 Jun 10;269(23):16397-402.
REF 10 Negative transcriptional regulation of the interferon-gamma promoter by glucocorticoids and dominant negative mutants of c-Jun. J Biol Chem. 1995 May 26;270(21):12548-56.
REF 11 Cyclic AMP- and phorbol ester-induced transcriptional activation are mediated by the same enhancer element in the human vasoactive intestinal peptide gene. J Biol Chem. 1991 Feb 25;266(6):3882-7.
REF 12 Composite glucocorticoid regulation at a functionally defined negative glucocorticoid response element of the human corticotropin-releasing hormone gene. Mol Endocrinol. 1999 Oct;13(10):1629-44.
REF 13 The Megakaryocyte/Platelet-specific enhancer of the alpha2beta1 integrin gene: two tandem AP1 sites and the mitogen-activated protein kinase signal... Blood. 1999 Mar 1;93(5):1600-11.
REF 14 Human antioxidant-response-element-mediated regulation of type 1 NAD(P)H:quinone oxidoreductase gene expression. Effect of sulfhydryl modifying age... Eur J Biochem. 1994 Nov 15;226(1):31-9.
REF 15 Role of distinct mitogen-activated protein kinase pathways and cooperation between Ets-2, ATF-2, and Jun family members in human urokinase-type plasminogen activator gene induction by interleukin-1 and tetradecanoyl phorbol acetate. Mol Cell Biol. 1999 Sep;19(9):6240-52.
REF 16 Thyroid hormone inhibits the human prolactin gene promoter by interfering with activating protein-1 and estrogen stimulations. Mol Endocrinol. 1997 Jun;11(7):986-96.
REF 17 Expression of human p53 requires synergistic activation of transcription from the p53 promoter by AP-1, NF-kappaB and Myc/Max. Oncogene. 1999 Apr 29;18(17):2728-38.
REF 18 The jun proto-oncogene is positively autoregulated by its product, Jun/AP-1. Cell. 1988 Dec 2;55(5):875-85.
REF 19 Identification of hypoxia-inducible factor 1 ancillary sequence and its function in vascular endothelial growth factor gene induction by hypoxia an... J Biol Chem. 2001 Jan 19;276(3):2292-8.
REF 20 Transitional change in interaction between HIF-1 and HNF-4 in response to hypoxia. J Hum Genet. 1999;44(5):293-9.
REF 21 Identification of a hypoxia response element in the transferrin receptor gene. J Biol Chem. 1999 Aug 20;274(34):24147-52.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.