Target Regulator(s) Information (Transcription Factor)
| Target General Information | Top | ||||
|---|---|---|---|---|---|
| Target ID | T15048 | Target Info | |||
| Target Name | Insulin-like growth factor-binding protein 1 (IGFBP1) | ||||
| Synonyms | Placental protein 12; PP12; KITLG; IGFBP-1; IGF-binding protein 1; IBP1; IBP-1 | ||||
| Target Type | Literature-reported Target | ||||
| Gene Name | IGFBP1 | ||||
| Biochemical Class | Insulin-like growth factor binding | ||||
| UniProt ID | |||||
| The Transcription Factors (TFs) Regulating This Target | Top | ||||
|---|---|---|---|---|---|
| TF Name | Forkhead box protein A1 (FOXA1) | ||||
| Classification | Superclass | Helix-turn-helix | |||
| Class | Fork head / winged helix | ||||
| Family | Tissue-specific regulators | ||||
| Evidence Score (E-score) | 2 | + | |||
| 1 | Chloramphenicol Acetyltransferase Assay, Luciferase Reporter Assay, Electrophoretic Mobility Shift Assay, DNase I Footprint Analysis | [1] | |||
| 2 | DNase I Footprint Analysis | [2] | |||
| UniProt ID | |||||
| Sequence |
MLGTVKMEGHETSDWNSYYADTQEAYSSVPVSNMNSGLGSMNSMNTYMTMNTMTTSGNMT
PASFNMSYANPGLGAGLSPGAVAGMPGGSAGAMNSMTAAGVTAMGTALSPSGMGAMGAQQ AASMNGLGPYAAAMNPCMSPMAYAPSNLGRSRAGGGGDAKTFKRSYPHAKPPYSYISLIT MAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVARSPDKPGK GSYWTLHPDSGNMFENGCYLRRQKRFKCEKQPGAGGGGGSGSGGSGAKGGPESRKDPSGA SNPSADSPLHRGVHGKTGQLEGAPAPGPAASPQTLDHSGATATGGASELKTPASSTAPPI SSGPGALASVPASHPAHGLAPHESQLHLKGDPHYSFNHPFSINNLMSSSEQQHKLDFKAY EQALQYSPYGSTLPASLPLGSASVTTRSPIEPSALEPAYYQGVYSRPVLNTS |
||||
| The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
| Apolipoproteins | [+] 3 Apolipoproteins Co-regulated By This TF | + | |||
| 1 | Apolipoprotein A-I (APOA1) | Clinical trial Target | Target Info | [3] | |
| 2 | Apolipoprotein B-100 (APOB) | Clinical trial Target | Target Info | [4] | |
| 3 | Apolipoprotein E (APOE) | Clinical trial Target | Target Info | [5] | |
| Growth factor binding | [+] 1 Growth factor binding Co-regulated By This TF | + | |||
| 1 | Insulin-like growth factor-binding protein 1 (IGFBP1) | Literature-reported Target | Target Info | [1] | |
| TF Name | Forkhead box protein A2 (FOXA2) | ||||
| Classification | Superclass | Helix-turn-helix | |||
| Class | Fork head / winged helix | ||||
| Family | Tissue-specific regulators | ||||
| Evidence Score (E-score) | 1 | + | |||
| 1 | Chloramphenicol Acetyltransferase Assay, Luciferase Reporter Assay, Electrophoretic Mobility Shift Assay, DNase I Footprint Analysis | [1] | |||
| UniProt ID | |||||
| Sequence |
MLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNAGLGMNGMNTYMSMSAAAMGSGSGNMSA
GSMNMSSYVGAGMSPSLAGMSPGAGAMAGMGGSAGAAGVAGMGPHLSPSLSPLGGQAAGA MGGLAPYANMNSMSPMYGQAGLSRARDPKTYRRSYTHAKPPYSYISLITMAIQQSPNKML TLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSG NMFENGCYLRRQKRFKCEKQLALKEAAGAAGSGKKAAAGAQASQAQLGEAAGPASETPAG TESPHSSASPCQEHKRGGLGELKGTPAAALSPPEPAPSPGQQQQAAAHLLGPPHHPGLPP EAHLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPG SLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS |
||||
| The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
| Apolipoproteins | [+] 2 Apolipoproteins Co-regulated By This TF | + | |||
| 1 | Apolipoprotein A-I (APOA1) | Clinical trial Target | Target Info | [3] | |
| 2 | Apolipoprotein B-100 (APOB) | Clinical trial Target | Target Info | [6] | |
| Growth factor binding | [+] 1 Growth factor binding Co-regulated By This TF | + | |||
| 1 | Insulin-like growth factor-binding protein 1 (IGFBP1) | Literature-reported Target | Target Info | [1] | |
| References | Top | ||||
|---|---|---|---|---|---|
| REF 1 | Hepatic nuclear factor 3 and high mobility group I/Y proteins bind the insulin response element of the insulin-like growth factor-binding protein-1 promoter. Endocrinology. 1997 Oct;138(10):4291-300. | ||||
| REF 2 | Loss of Interdependent Binding by the FoxO1 and FoxA1/A2 Forkhead Transcription Factors Culminates in Perturbation of Active Chromatin Marks and Bi... J Biol Chem. 2016 Apr 15;291(16):8848-61. | ||||
| REF 3 | COUP orphan receptors are negative regulators of retinoic acid response pathways. Mol Cell Biol. 1992 Oct;12(10):4666-76. | ||||
| REF 4 | The mechanism by which the human apolipoprotein B gene reducer operates involves blocking of transcriptional activation by hepatocyte nuclear facto... Mol Cell Biol. 1993 Mar;13(3):1534-46. | ||||
| REF 5 | Structure of the hepatic control region of the human apolipoprotein E/C-I gene locus. J Biol Chem. 1995 Sep 22;270(38):22577-85. | ||||
| REF 6 | Identification and characterization of a 315-base pair enhancer, located more than 55 kilobases 5' of the apolipoprotein B gene, that confers expression in the intestine. J Biol Chem. 2000 Aug 25;275(34):26637-48. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.