Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T81100
|
||||
| Former ID |
TTDC00336
|
||||
| Target Name |
mRNA of sodium-glucosetransporter-2
|
||||
| Gene Name |
SLC5A2
|
||||
| Synonyms |
mRNA of Low affinity sodium-glucose cotransporter; mRNA of Na(+)/glucose cotransporter 2; mRNA of SGLT2; mRNA of SLC5A2; mRNA of Sodium/glucosecotransporter 2; mRNA of Solute carrierfamily 5 member 2; SLC5A2
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Type 2 diabetes [ICD9: 250; ICD10: E11] | ||||
| Function |
Efficient substrate transport in mammalian kidney is provided by the concerted action of a low affinity high capacity and a high affinity low capacity Na(+)/glucose cotransporter arranged in series along kidney proximal tubules.
|
||||
| BioChemical Class |
Solute:sodium symporter
|
||||
| Target Validation |
T81100
|
||||
| UniProt ID | |||||
| Sequence |
MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGR
SMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNALFVVLLLGWLFAPVYLTA GVITMPQYLRKRFGGRRIRLYLSVLSLFLYIFTKISVDMFSGAVFIQQALGWNIYASVIA LLGITMIYTVTGGLAALMYTDTVQTFVILGGACILMGYAFHEVGGYSGLFDKYLGAATSL TVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWPALLLGLTIVSGWYWCSDQVIVQR CLAGKSLTHIKAGCILCGYLKLTPMFLMVMPGMISRILYPDEVACVVPEVCRRVCGTEVG CSNIAYPRLVVKLMPNGLRGLMLAVMLAALMSSLASIFNSSSTLFTMDIYTRLRPRAGDR ELLLVGRLWVVFIVVVSVAWLPVVQAAQGGQLFDYIQAVSSYLAPPVSAVFVLALFVPRV NEQGAFWGLIGGLLMGLARLIPEFSFGSGSCVQPSACPAFLCGVHYLYFAIVLFFCSGLL TLTVSLCTAPIPRKHLHRLVFSLRHSKEEREDLDADEQQGSSLPVQNGCPESAMEMNEPQ APAPSLFRQCLLWFCGMSRGGVGSPPPLTQEEAAAAARRLEDISEDPSWARVVNLNALLM MAVAVFLWGFYA |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | ISIS-SGLT2 | Drug Info | Phase 1 | Type 2 diabetes | [1] |
| Inhibitor | 10-methoxy-N(1)-methylburnamine-17-O-veratrate | Drug Info | [2] | ||
| ACEROGENIN B | Drug Info | [3] | |||
| Acerogenin C | Drug Info | [3] | |||
| Alstiphyllanine D | Drug Info | [2] | |||
| Alstiphyllanine E | Drug Info | [2] | |||
| Alstiphyllanine F | Drug Info | [2] | |||
| Burnamine-17-O-3',4',5'-trimethoxybenzoate | Drug Info | [2] | |||
| FORMONONETIN | Drug Info | [4] | |||
| KURAIDIN | Drug Info | [4] | |||
| KURARINONE | Drug Info | [4] | |||
| Kushenol N | Drug Info | [4] | |||
| MAACKIAIN | Drug Info | [4] | |||
| O-spiroketal glucoside | Drug Info | [5] | |||
| SERGLIFLOZIN A | Drug Info | [6] | |||
| Sophoraflavanone G | Drug Info | [4] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| Reactome | Hexose transport | ||||
| Na+-dependent glucose transporters | |||||
| Inositol transporters | |||||
| WikiPathways | NRF2 pathway | ||||
| Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds | |||||
| References | |||||
| REF 1 | Clinical pipeline report, company report or official report of ISIS Pharmaceuticals (2011). | ||||
| REF 2 | Bioorg Med Chem. 2010 Mar 15;18(6):2152-8. Epub 2010 Feb 6.Alstiphyllanines E-H, picraline and ajmaline-type alkaloids from Alstonia macrophylla inhibiting sodium glucose cotransporter. | ||||
| REF 3 | Bioorg Med Chem Lett. 2010 Feb 1;20(3):1070-4. Epub 2009 Dec 11.Cyclic diarylheptanoids as Na+-glucose cotransporter (SGLT) inhibitors from Acer nikoense. | ||||
| REF 4 | Bioorg Med Chem. 2007 May 15;15(10):3445-9. Epub 2007 Mar 12.Na+-glucose cotransporter (SGLT) inhibitory flavonoids from the roots of Sophora flavescens. | ||||
| REF 5 | Bioorg Med Chem. 2010 Jun 15;18(12):4422-32. Epub 2010 Apr 29.ortho-Substituted C-aryl glucosides as highly potent and selective renal sodium-dependent glucose co-transporter 2 (SGLT2) inhibitors. | ||||
| REF 6 | Bioorg Med Chem. 2010 Mar 15;18(6):2178-94. Epub 2010 Feb 4.Novel C-aryl glucoside SGLT2 inhibitors as potential antidiabetic agents: 1,3,4-Thiadiazolylmethylphenyl glucoside congeners. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.