Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T56365
|
||||
| Former ID |
TTDC00135
|
||||
| Target Name |
B-lymphocyte antigen CD19
|
||||
| Gene Name |
CD19
|
||||
| Synonyms |
B-lymphocyte surface antigen B4; Differentiation antigen CD19; Leu-12; CD19
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Acute lymphoblastic leukemia [ICD9: 204.0, 556; ICD10: C91.0] | ||||
| Autoimmune diabetes [ICD10: E08-E13] | |||||
| B-cell lymphoma [ICD9: 202.8; ICD10: C85.1] | |||||
| Chronic lymphocytic leukaemia [ICD10: C91] | |||||
| Diffuse large B-cell lymphoma [ICD9: 200; ICD10: C83.3] | |||||
| Hematologic malignancies [ICD9: 200-209; ICD10: C81-C86] | |||||
| Lymphoma; Chronic lymphocytic leukemia; Multiple myeloma [ICD9: 202.8, 203.0, 204.1, 208.9; ICD10: C81-C86, C90, C91-C95, C91.1] | |||||
| Leukemia [ICD9: 208.9; ICD10: C90-C95] | |||||
| Non-hodgkin's lymphoma [ICD10: C85] | |||||
| Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06] | |||||
| Scleroderma [ICD9: 701.0710.1; ICD10: L94.0-L94.1, M34] | |||||
| Function |
Assembles with the antigen receptor of B-lymphocytes in order to decrease the threshold for antigen receptor-dependent stimulation.
|
||||
| BioChemical Class |
Immunoglobulin
|
||||
| Target Validation |
T56365
|
||||
| UniProt ID | |||||
| Sequence |
MPPPRLLFFLLFLTPMEVRPEEPLVVKVEEGDNAVLQCLKGTSDGPTQQLTWSRESPLKP
FLKLSLGLPGLGIHMRPLAIWLFIFNVSQQMGGFYLCQPGPPSEKAWQPGWTVNVEGSGE LFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCLPPRDSL NQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVHPKGPKSLLSLELKDDRPARDMW VMETGLLLPRATAQDAGKYYCHRGNLTMSFHLEITARPVLWHWLLRTGGWKVSAVTLAYL IFCLCSLVGILHLQRALVLRRKRKRMTDPTRRFFKVTPPPGSGPQNQYGNVLSLPTPTSG LGRAQRWAAGLGGTAPSYGNPSSDVQADGALGSRSPPGVGPEEEEGEGYEEPDSEEDSEF YENDSNLGQDQLSQDGSGYENPEDEPLGPEDEDSFSNAESYENEDEELTQPVARTMDFLS PHGSAWDPSREATSLGSQSYEDMRGILYAAPQLRSIRGQPGPNHEEDADSYENMDNPDGP DPAWGGGGRMGTWSTR |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Blinatumomab | Drug Info | Approved | Acute lymphoblastic leukemia | [1], [2] |
| CTL019 | Drug Info | Phase 2 | Chronic lymphocytic leukaemia | [3] | |
| JCAR015 | Drug Info | Phase 2 | B-cell lymphoma | [4] | |
| MDX-1342 | Drug Info | Phase 2 | Leukemia | [5] | |
| MOR-208 | Drug Info | Phase 2 | Autoimmune diabetes | [6] | |
| SAR-3419 | Drug Info | Phase 2 | Non-hodgkin's lymphoma | [7] | |
| Xmab 5871 | Drug Info | Phase 2 | Autoimmune diabetes | [8] | |
| JCAR014 | Drug Info | Phase 1/2 | Non-hodgkin's lymphoma | [9] | |
| JCAR017 | Drug Info | Phase 1/2 | Leukemia | [10] | |
| KTE-C19 CAR | Drug Info | Phase 1/2 | Diffuse large B-cell lymphoma | [11] | |
| Xmab5871 | Drug Info | Phase 1/2 | Rheumatoid arthritis | [12] | |
| AFM11 | Drug Info | Phase 1 | Non-hodgkin's lymphoma | [13] | |
| Combotox | Drug Info | Phase 1 | Leukemia | [14] | |
| MEDI-551 | Drug Info | Phase 1 | Lymphoma; Chronic lymphocytic leukemia; Multiple myeloma | [15], [16] | |
| MEDl-551 | Drug Info | Phase 1 | Scleroderma | [17] | |
| SGN-19A | Drug Info | Preclinical | Hematologic malignancies | [18] | |
| Modulator | AFM11 | Drug Info | [19] | ||
| Anti-CD22/CD19 mab-toxin conjugate | Drug Info | [20] | |||
| Blinatumomab | Drug Info | [21] | |||
| Combotox | Drug Info | ||||
| CTL019 | Drug Info | [22] | |||
| JCAR014 | Drug Info | [23] | |||
| JCAR015 | Drug Info | [23] | |||
| JCAR017 | Drug Info | [23] | |||
| Xmab 5871 | Drug Info | ||||
| Xmab5871 | Drug Info | [19] | |||
| Inhibitor | KTE-C19 CAR | Drug Info | [24] | ||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | PI3K-Akt signaling pathway | ||||
| Hematopoietic cell lineage | |||||
| B cell receptor signaling pathway | |||||
| Epstein-Barr virus infection | |||||
| Primary immunodeficiency | |||||
| NetPath Pathway | IL-7 Signaling Pathway | ||||
| PANTHER Pathway | B cell activation | ||||
| Pathway Interaction Database | BCR signaling pathway | ||||
| Reactome | PIP3 activates AKT signaling | ||||
| Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell | |||||
| Constitutive Signaling by Aberrant PI3K in Cancer | |||||
| Antigen activates B Cell Receptor (BCR) leading to generation of second messengers | |||||
| WikiPathways | Human Complement System | ||||
| Signaling by the B Cell Receptor (BCR) | |||||
| PIP3 activates AKT signaling | |||||
| B Cell Receptor Signaling Pathway | |||||
| Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell | |||||
| References | |||||
| REF 1 | ClinicalTrials.gov (NCT02013167) Blinatumomab Versus Standard of Care Chemotherapy in Patients With Relapsed or Refractory Acute Lymphoblastic Leukemia (ALL) | ||||
| REF 2 | ClinicalTrials.gov (NCT02393859) Phase 3 Trial of Blinatumomab vs Standard Chemotherapy in Pediatric Subjects With HR First Relapse B-precursor ALL | ||||
| REF 3 | ClinicalTrials.gov (NCT02445248) Study of Efficacy and Safety of CTL019 in Adult DLBCL Patients. U.S. National Institutes of Health. | ||||
| REF 4 | ClinicalTrials.gov (NCT02535364) Study Evaluating the Efficacy and Safety of JCAR015 in Adult B-cell Acute Lymphoblastic Leukemia (B-ALL). | ||||
| REF 5 | ClinicalTrials.gov (NCT01974479) Pilot Study of Redirected Haploidentical Natural Killer Cell Infusions for B-Lineage Acute Lymphoblastic Leukemia. U.S. National Institutes of Health. | ||||
| REF 6 | ClinicalTrials.gov (NCT01685008) Study of Fc-Optimized Anti-CD19 Antibody (MOR00208) to Treat Non-Hodgkin?? Lymphoma (NHL). U.S. National Institutes of Health. | ||||
| REF 7 | A dose-escalation study of SAR3419, an anti-CD19 antibody maytansinoid conjugate, administered by intravenous infusion once weekly in patients with relapsed/refractory B-cell non-Hodgkin lymphoma. Clin Cancer Res. 2014 Jan 1;20(1):213-20. | ||||
| REF 8 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800035125) | ||||
| REF 9 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800041075) | ||||
| REF 10 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800041076) | ||||
| REF 11 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800039436) | ||||
| REF 12 | ClinicalTrials.gov (NCT02867098) XmAb5871 Bioavailability Study | ||||
| REF 13 | ClinicalTrials.gov (NCT02106091) Safety Study to Assess AFM11 in Patients With Relapsed and/or Refractory CD19 Positive B-cell NHL or B-precursor ALL. U.S. National Institutes of Health. | ||||
| REF 14 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027936) | ||||
| REF 15 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7992). | ||||
| REF 16 | Clinical pipeline report, company report or official report of MedImmune (2011). | ||||
| REF 17 | CD19 as an attractive target for antibody-based therapy. MAbs. 2012 Sep-Oct;4(5):571-7. | ||||
| REF 18 | 2011 Pipeline of Seattle Genetics. | ||||
| REF 19 | Bispecific antibodies rise again. Nat Rev Drug Discov. 2014 Nov;13(11):799-801. doi: 10.1038/nrd4478. | ||||
| REF 20 | Immunotoxins against CD19 and CD22 are effective in killing precursor-B acute lymphoblastic leukemia cells in vitro. Leukemia. 2000 May;14(5):853-8. | ||||
| REF 21 | 2014 FDA drug approvals. Nat Rev Drug Discov. 2015 Feb;14(2):77-81. | ||||
| REF 22 | Clinical pipeline report, company report or official report of Novartis. | ||||
| REF 23 | Clinical pipeline report, company report or official report of JUNO Therapeutics. | ||||
| REF 24 | Clinical pipeline report, company report or official report of Kite Pharma. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.