Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T27376
|
||||
Former ID |
TTDI01909
|
||||
Target Name |
GABA A receptor delta subunit
|
||||
Gene Name |
GABRD
|
||||
Synonyms |
GABA(A) receptor subunit delta; Gammaaminobutyric acid receptor subunit delta; GABRD
|
||||
Target Type |
Successful
|
||||
Disease | Anesthesia [ICD9: 338; ICD10: R20.0] | ||||
Anxiety disorder [ICD9: 300, 311; ICD10: F32, F40-F42] | |||||
Epilepsy [ICD10: G40] | |||||
Insomnia [ICD9: 307.41, 307.42, 327.0, 780.51, 780.52; ICD10: F51.0, G47.0] | |||||
Neuropathic pain [ICD9: 356.0, 356.8; ICD10: G64, G90.0] | |||||
Unspecified [ICD code not available] | |||||
Function |
GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel.
|
||||
BioChemical Class |
Ligand-gated ion channel
|
||||
UniProt ID | |||||
Sequence |
MDAPARLLAPLLLLCAQQLRGTRAMNDIGDYVGSNLEISWLPNLDGLIAGYARNFRPGIG
GPPVNVALALEVASIDHISEANMEYTMTVFLHQSWRDSRLSYNHTNETLGLDSRFVDKLW LPDTFIVNAKSAWFHDVTVENKLIRLQPDGVILYSIRITSTVACDMDLAKYPMDEQECML DLESYGYSSEDIVYYWSESQEHIHGLDKLQLAQFTITSYRFTTELMNFKSAGQFPRLSLH FHLRRNRGVYIIQSYMPSVLLVAMSWVSFWISQAAVPARVSLGITTVLTMTTLMVSARSS LPRASAIKALDVYFWICYVFVFAALVEYAFAHFNADYRKKQKAKVKVSRPRAEMDVRNAI VLFSLSAAGVTQELAISRRQRRVPGNLMGSYRSVGVETGETKKEGAARSGGQGGIRARLR PIDADTIDIYARAVFPAAFAAVNVIYWAAYAM |
||||
Drugs and Mode of Action | |||||
Drug(s) | Gaboxadol | Drug Info | Approved | Insomnia | [467660], [537521] |
Ganaxolone | Drug Info | Phase 2 | Epilepsy | [536934] | |
PF-4480682 | Drug Info | Discontinued in Phase 2 | Neuropathic pain | [548430] | |
PF-2393296 | Drug Info | Discontinued in Phase 1 | Neuropathic pain | [548716] | |
Co-60549 | Drug Info | Terminated | Anxiety disorder | [546228] | |
Org-20599 | Drug Info | Terminated | Anesthesia | [545545] | |
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
References | |||||
Ref 467660 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4322). | ||||
Ref 536934 | Progress report on new antiepileptic drugs: a summary of the Ninth Eilat Conference (EILAT IX). Epilepsy Res. 2009 Jan;83(1):1-43. Epub 2008 Nov 12. | ||||
Ref 537521 | Highway driving performance and cognitive functioning the morning after bedtime and middle-of-the-night use of gaboxadol, zopiclone and zolpidem. J Sleep Res. 2009 Jun 22. | ||||
Ref 545545 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003651) | ||||
Ref 546228 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007012) | ||||
Ref 534312 | The anaesthetic action and modulation of GABAA receptor activity by the novel water-soluble aminosteroid Org 20599. Neuropharmacology. 1996;35(9-10):1209-22. | ||||
Ref 543815 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 416). |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.