Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T24334
|
||||
Former ID |
TTDR00596
|
||||
Target Name |
Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial
|
||||
Gene Name |
dut
|
||||
Synonyms |
DUTP pyrophosphatase; DUTPase; Deoxyuridine 5'-triphosphate nucleotidohydrolase; Deoxyuridine triphosphate nucleotidohydrolase; dut
|
||||
Target Type |
Research
|
||||
Function |
This enzyme is involved in nucleotide metabolism: it produces dUMP, the immediate precursor of thymidine nucleotides and it decreases the intracellular concentration of dUTP so that uracil cannot be incorporated into DNA.
|
||||
BioChemical Class |
Acid anhydrides hydrolase
|
||||
Target Validation |
T24334
|
||||
UniProt ID | |||||
EC Number |
EC3.6.1.23
|
||||
Sequence |
MKKIDVKILDPRVGKEFPLPTYATSGSAGLDLRACLNDAVELAPGDTTLVPTGLAIHIAD
PSLAAMMLPRSGLGHKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDSFTIQPGERIAQMI FVPVVQAEFNLVEDFDATDRGEGGFGHSGRQ |
||||
Inhibitor | 1-(3-tritylaminopropyl)uracil | Drug Info | [1] | ||
1-[(Z)-4-trityloxy-2-butenyl]uracil | Drug Info | [1] | |||
1-[2-(trityloxy)ethoxymethyl]uracil | Drug Info | [1] | |||
1-[4-hydroxy-3-(tritylaminomethyl)butyl]uracil | Drug Info | [1] | |||
2'-deoxyuridine 5'-alpha,beta-imido-diphosphate | Drug Info | [2] | |||
2'-Deoxyuridine 5'-Alpha,Beta-Imido-Triphosphate | Drug Info | [3] | |||
2'-deoxyuridylic acid | Drug Info | [3] | |||
Acetate Ion | Drug Info | [3] | |||
Deoxyuridine-5'-Diphosphate | Drug Info | [2] | |||
Deoxyuridine-5'-Triphosphate | Drug Info | [3] | |||
Pathways | |||||
PANTHER Pathway | De novo pyrimidine deoxyribonucleotide biosynthesis | ||||
References | |||||
REF 1 | J Med Chem. 2006 Jul 13;49(14):4183-95.Acyclic nucleoside analogues as inhibitors of Plasmodium falciparum dUTPase. | ||||
REF 2 | DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Nucleic Acids Res. 2011 Jan;39(Database issue):D1035-4. Nucleic Acids Res. 2011 January | ||||
REF 3 | How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.